Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1098 bp · TkA03G358790|TK1151|cDNA
ATGTGGAGTAATCTTCCTTCCGATCTCCTATCCAACATCTTCTCTTACCTTCCACCTCACTCCATCCCCCGCGCCATGGCGGTCTGCCGCCACTGGCGGTCAGCAACCGGCGACACAAAACGGTACCACCGCCACAACCACCACCCGCCATGGTTCATCGCCTTACCCACCCATAGAAACCATTTGTGTTTTATTCATAATCCAATCGAAAACACGTGGCACTCACTCAATCTCAAACATGTTCCTAAATTAATCAGACC...
1098 bp · TkA03G358790|TK1151|CDS
ATGTGGAGTAATCTTCCTTCCGATCTCCTATCCAACATCTTCTCTTACCTTCCACCTCACTCCATCCCCCGCGCCATGGCGGTCTGCCGCCACTGGCGGTCAGCAACCGGCGACACAAAACGGTACCACCGCCACAACCACCACCCGCCATGGTTCATCGCCTTACCCACCCATAGAAACCATTTGTGTTTTATTCATAATCCAATCGAAAACACGTGGCACTCACTCAATCTCAAACATGTTCCTAAATTAATCAGACC...
Protein
Download Protein FASTA365 aa · TkA03G358790|TK1151|PROTEIN
MWSNLPSDLLSNIFSYLPPHSIPRAMAVCRHWRSATGDTKRYHRHNHHPPWFIALPTHRNHLCFIHNPIENTWHSLNLKHVPKLIRPVSTIGGHGLILFKGATGGVPIQLSVCNPFTGQFGQLPPLQKPRRNPAVGIIEVCPCQFKVYVAGGMSEAATGGGATSYEPTLEMFDSKSGKWTTVGSMPVEFAVRLTVWTPNESVYSNGVLYWMTSARAYSIMGFEIKANKWMEFSVPNGYMLEFAALVPRNGKLVVIGGVEG...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G358790 |
|---|---|
| TK1151 ID | TkA03G358790 |
| OH-1004 ID | LXL04_008560 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 98.400 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G358790 |
|---|---|
| Location | Chr03:88517860-88518957 (-) |
| Description | Similar to UFO: Protein UNUSUAL FLORAL ORGANS |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009908 flower development Biological Process GO:0009909 regulation of flower development Biological Process GO:0009933 meristem structural organization Biological Process GO:0010074 maintenance of meristem identity Biological Process GO:0010087 phloem or xylem histogenesis Biological Process GO:0010193 response to ozone Biological Process GO:0010305 leaf vascular tissue pattern formation Biological Process GO:0010928 regulation of auxin mediated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process |
| KEGG gene cross-reference | ath:AT1G27340 ath:AT1G30950 ath:AT3G61590 ath:AT5G15710 osa:107277138 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12937F-box-like2-44 aaPF00646F-box2-42 aaPF13964Beta-prop_Calicin64-203 aaPF01344Kelch_167-76 aaPF07646Kelch_267-77 aaPF07646Kelch_292-109 aaPF08268FBA_393-266 aaPF07734FBA_195-232 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G358790 | PF12937 | F-box-like | 2 | 44 | 1.2e-12 | 48.1 |
| TkA03G358790 | PF00646 | F-box | 2 | 42 | 4.9e-12 | 45.9 |
| TkA03G358790 | PF13964 | Beta-prop_Calicin | 64 | 203 | 9.6e-06 | 25.5 |
| TkA03G358790 | PF01344 | Kelch_1 | 67 | 76 | 2.3e-07 | 30.9 |
| TkA03G358790 | PF07646 | Kelch_2 | 67 | 77 | 0.75 | 10.6 |
| TkA03G358790 | PF07646 | Kelch_2 | 92 | 109 | 0.75 | 10.6 |
| TkA03G358790 | PF08268 | FBA_3 | 93 | 266 | 8.9e-08 | 32.2 |
| TkA03G358790 | PF07734 | FBA_1 | 95 | 232 | 0.00015 | 21.6 |
| TkA03G358790 | PF03478 | Beta-prop_KIB1-4 | 103 | 268 | 0.00036 | 20.8 |
| TkA03G358790 | PF01344 | Kelch_1 | 146 | 186 | 2.3e-07 | 30.9 |
| TkA03G358790 | PF07646 | Kelch_2 | 146 | 186 | 0.75 | 10.6 |
| TkA03G358790 | PF13964 | Beta-prop_Calicin | 220 | 264 | 9.6e-06 | 25.5 |
| TkA03G358790 | PF01344 | Kelch_1 | 247 | 261 | 2.3e-07 | 30.9 |
| TkA03G358790 | PF07646 | Kelch_2 | 249 | 259 | 0.75 | 10.6 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.