RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G358160
Reference: TK1151 Chr: Chr03 Coordinates: 88343626-88344185 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

432 bp · TkA03G358160|TK1151|cDNA

ATGCAAAATAGTAAAGTAGTAAATGCTACTAAATGGAGTCGTTTATTTCTTGTTTTTTTTTCAGGATCAGATATACCAAATGGAACACTTTCTTCTTCCAAAAGCAAGTTTGATGATAAGATAGAAGCTTCTTCTGCTAAAATGTACTTTCATTACTACGGGCAATTGCTTCATCAGCAAAATATGTTACAGGATTATGTGAGCATAGGATCATATTATGCTGCGGTGATTGAGAACCAAGCGGATTTTGCTGGCCGTGT...

CDS

Download CDS FASTA

432 bp · TkA03G358160|TK1151|CDS

ATGCAAAATAGTAAAGTAGTAAATGCTACTAAATGGAGTCGTTTATTTCTTGTTTTTTTTTCAGGATCAGATATACCAAATGGAACACTTTCTTCTTCCAAAAGCAAGTTTGATGATAAGATAGAAGCTTCTTCTGCTAAAATGTACTTTCATTACTACGGGCAATTGCTTCATCAGCAAAATATGTTACAGGATTATGTGAGCATAGGATCATATTATGCTGCGGTGATTGAGAACCAAGCGGATTTTGCTGGCCGTGT...

Protein

Download Protein FASTA

143 aa · TkA03G358160|TK1151|PROTEIN

MQNSKVVNATKWSRLFLVFFSGSDIPNGTLSSSKSKFDDKIEASSAKMYFHYYGQLLHQQNMLQDYVSIGSYYAAVIENQADFAGRVVVDVGAGSGILSLFAAQAGAKHVYAVEASEMANYAQKLIVGNPILAQIITVSTLTS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G358160
TK1151 IDTkA03G358160
OH-1004 IDLXL04_031919
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)98.600
Protein coverage (%)TK1151 97.902 / OH-1004 46.823
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G358160
LocationChr03:88343626-88344185 (-)
DescriptionSimilar to PRMT13: Probable histone-arginine methyltransferase 1.3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g06930 Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability (By similarity).
PARAQUAT TOLERANCE3 Is an E3 Ligase That Switches off Activated Oxidative Response by Targeting Histone-Modifying PROTEIN METHYLTRANSFERASE4b.2016 · DOI: 10.1371/journal.pgen.1006332
At5g49020 Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: A2YPT7 Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability. No verified direct reference in this release
Os07g0671700 Methylates (mono- and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in several proteins involved in DNA packaging, transcription regulation, and mRNA stability. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_031919 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006338 chromatin remodeling Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0009651 response to salt stress Biological Process
GO:0009909 regulation of flower development Biological Process
GO:0010228 vegetative to reproductive phase transition of meristem Biological Process
GO:0019919 peptidyl-arginine methylation, to asymmetrical-dimethyl arginine Biological Process
GO:0032259 methylation Biological Process
GO:0040029 epigenetic regulation of gene expression Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0046686 response to cadmium ion Biological Process
GO:1902884 positive regulation of response to oxidative stress Biological Process
KEGG gene cross-reference
ath:AT3G06930
ath:AT5G49020
dosa:Os07g0671700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.274
Rank 1 · TkA03G358160 · TK1151
Nucleus0.205
Rank 2 · TkA03G358160 · TK1151
Endoplasmic reticulum0.181
Rank 3 · TkA03G358160 · TK1151
Extracellular0.156
Rank 4 · TkA03G358160 · TK1151
Lysosome / Vacuole0.117
Rank 5 · TkA03G358160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02475TRM5-TYW2_MTfase38-54 aa
PF09243Rsm2261-127 aa
PF10294Methyltransf_1671-141 aa
PF13489Methyltransf_2377-122 aa
PF26891Phage_N4_Gp177-126 aa
PF08003Methyltransf_977-119 aa
PF13679Methyltransf_3280-119 aa
PF03602Cons_hypoth9581-119 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G358160PF02475TRM5-TYW2_MTfase38540.04314.5
TkA03G358160PF09243Rsm22611270.1312.4
TkA03G358160PF10294Methyltransf_16711410.06313.8
TkA03G358160PF13489Methyltransf_23771220.001519.0
TkA03G358160PF26891Phage_N4_Gp1771260.1513.1
TkA03G358160PF08003Methyltransf_9771190.2211.1
TkA03G358160PF13679Methyltransf_32801190.1812.5
TkA03G358160PF03602Cons_hypoth95811190.01515.7
TkA03G358160PF06325PrmA831299.8e-0832.5
TkA03G358160PF05175MTS841200.001518.8
TkA03G358160PF01728FtsJ841190.002718.4
TkA03G358160PF02475TRM5-TYW2_MTfase851180.04314.5
TkA03G358160PF13649Methyltransf_25881260.0009720.5
TkA03G358160PF08241Methyltransf_11891310.01117.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q84W92Arabidopsis thalianasp|Q84W92|ANM13_ARATH Probable histone-arginine methyltransferase 1.382.100%Swiss-ProtHigh
A3KPF2Arabidopsis thalianasp|A3KPF2|ANM14_ARATH Probable histone-arginine methyltransferase 1.480.500%Swiss-ProtHigh
A2YPT7Oryza sativa subsp. indicasp|A2YPT7|CARM1_ORYSI Probable histone-arginine methyltransferase CARM172.700%Swiss-ProtHigh
Q7XI75Oryza sativa subsp. japonicasp|Q7XI75|CARM1_ORYSJ Probable histone-arginine methyltransferase CARM172.700%Swiss-ProtHigh

JBrowse

View in Genome Browser