TkA03G349250 | RubberDandelionOmics

Gene overview

TkA03G349250

Reference: TK1151 Chr: Chr03 Coordinates: 85947684-85948943 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1110 bp · TkA03G349250|TK1151|cDNA

GGGCTGCTTGAAGCAGTGAAAGAGTTGTTGCCACATGCGGAACATAGACAGTGTGCTCGCCATATATACGCAAACTTTAAGAAGTCGGGATACAATGGAGAGGAGTACAAATTCATTTTCTGGGCAGCTGCTAGTTGCACTGTTGAACCTGAATTCATGGAAGTAATGGACAGATTAAAGGCTATAGATGTGGAGGCATATGAGTACTTAATGGCCCGTAACCCGAATTCATGGTGTCGTGCTTACTTTAATCAAGATAG...

CDS

Download CDS FASTA

1110 bp · TkA03G349250|TK1151|CDS

GGGCTGCTTGAAGCAGTGAAAGAGTTGTTGCCACATGCGGAACATAGACAGTGTGCTCGCCATATATACGCAAACTTTAAGAAGTCGGGATACAATGGAGAGGAGTACAAATTCATTTTCTGGGCAGCTGCTAGTTGCACTGTTGAACCTGAATTCATGGAAGTAATGGACAGATTAAAGGCTATAGATGTGGAGGCATATGAGTACTTAATGGCCCGTAACCCGAATTCATGGTGTCGTGCTTACTTTAATCAAGATAG...

Protein

Download Protein FASTA

369 aa · TkA03G349250|TK1151|PROTEIN

GLLEAVKELLPHAEHRQCARHIYANFKKSGYNGEEYKFIFWAAASCTVEPEFMEVMDRLKAIDVEAYEYLMARNPNSWCRAYFNQDRACEAFENGISESFNAMIMDARKRPLLTMLEMIRLSVMERVATMHKVQERWDGPICPAIIKKLEKFGKDYRLWSVYSSGGGVFETRSAHASYCVDLGGWYCTCRLWELSGVPCVHAIAAMYFDQQNPEDFIDPVFSIEKFKSSYDTFIQPMNGSNLWHTTPYEKPLPPISRRMP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G349250`
TK1151 ID	TkA03G349250
OH-1004 ID	LXL04_030175
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	90.100
Protein coverage (%)	TK1151 100.000 / OH-1004 51.705 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G349250`
Location	Chr03:85947684-85948943 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030175` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkA03G349250 · TK1151

Cytoplasm0.105

Rank 2 · TkA03G349250 · TK1151

Cell membrane0.022

Rank 3 · TkA03G349250 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA03G349250 · TK1151

Mitochondrion0.012

Rank 5 · TkA03G349250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24529CFAP47102-119 aa

PF04434SWIM178-207 aa

PF15288zf-CCHC_6284-307 aa

PF00098zf-CCHC285-301 aa

PF24529CFAP47310-346 aa

PF24625DUF7626332-353 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G349250	`PF24529`	CFAP47	102	119	0.31	11.6
TkA03G349250	`PF04434`	SWIM	178	207	4.6e-09	36.3
TkA03G349250	`PF15288`	zf-CCHC_6	284	307	0.0092	16.5
TkA03G349250	`PF00098`	zf-CCHC	285	301	0.69	10.8
TkA03G349250	`PF24529`	CFAP47	310	346	0.31	11.6
TkA03G349250	`PF24625`	DUF7626	332	353	0.11	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card