TkA03G348850 | RubberDandelionOmics

Gene overview

TkA03G348850

Reference: TK1151 Chr: Chr03 Coordinates: 85844361-85844771 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

411 bp · TkA03G348850|TK1151|cDNA

ATGGCGGCTCAACCACGCGATGAAGCCAGTGTCACTGAACCTTGCCGTGTGGAGAATGGGCCGGGTAAGAAGAAGGAGTTGGGAGTAAACCCGAAGGTTATGATGGAAAGATTAGGAACCTTTTGGGATCCTGATGATCAAAGGGAGAGTCTTGAGTTAGAAGAGATGGTGAATCTGTTCGTTGGTGATGAGCCAAGCTTTGATGAAGTGAAAGAGGCGTTTGGCGTGTATGATAAGAACAACGATGGGTACATAGATGC...

CDS

Download CDS FASTA

411 bp · TkA03G348850|TK1151|CDS

ATGGCGGCTCAACCACGCGATGAAGCCAGTGTCACTGAACCTTGCCGTGTGGAGAATGGGCCGGGTAAGAAGAAGGAGTTGGGAGTAAACCCGAAGGTTATGATGGAAAGATTAGGAACCTTTTGGGATCCTGATGATCAAAGGGAGAGTCTTGAGTTAGAAGAGATGGTGAATCTGTTCGTTGGTGATGAGCCAAGCTTTGATGAAGTGAAAGAGGCGTTTGGCGTGTATGATAAGAACAACGATGGGTACATAGATGC...

Protein

Download Protein FASTA

136 aa · TkA03G348850|TK1151|PROTEIN

MAAQPRDEASVTEPCRVENGPGKKKELGVNPKVMMERLGTFWDPDDQRESLELEEMVNLFVGDEPSFDEVKEAFGVYDKNNDGYIDATELQSVLSDMGFLHFSESECEKMITGYDVDKDGKISFREFFKVVEDGFC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G348850`
TK1151 ID	TkA03G348850
OH-1004 ID	LXL04_008653
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G348850

Location Chr03:85844361-85844771 (+)

Description Similar to CML45: Probable calcium-binding protein CML45

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g29000`	Potential calcium sensor.	No verified direct reference in this release
`At5g39670`	Potential calcium sensor.	No verified direct reference in this release
`At3g47480`	Potential calcium sensor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0312600`	Potential calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008653 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1900425 negative regulation of defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016460 myosin II complex Cellular Component

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G29000

ath:AT3G47480

ath:AT5G39670

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.641

Rank 1 · TkA03G348850 · TK1151

Nucleus0.388

Rank 2 · TkA03G348850 · TK1151

Cell membrane0.083

Rank 3 · TkA03G348850 · TK1151

Endoplasmic reticulum0.075

Rank 4 · TkA03G348850 · TK1151

Mitochondrion0.060

Rank 5 · TkA03G348850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21008AIF-132-57 aa

PF14658EF-hand_935-55 aa

PF30551CFAP251_C41-112 aa

PF05042Caleosin46-68 aa

PF13499EF-hand_748-60 aa

PF13405EF-hand_650-60 aa

PF00036EF-hand_152-59 aa

PF23564EF-hand_FSTL163-135 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G348850	`PF21008`	AIF-1	32	57	0.0015	19.5
TkA03G348850	`PF14658`	EF-hand_9	35	55	0.0075	17.4
TkA03G348850	`PF30551`	CFAP251_C	41	112	0.0051	17.2
TkA03G348850	`PF05042`	Caleosin	46	68	0.39	11.3
TkA03G348850	`PF13499`	EF-hand_7	48	60	7.7e-13	49.3
TkA03G348850	`PF13405`	EF-hand_6	50	60	2.4e-13	49.2
TkA03G348850	`PF00036`	EF-hand_1	52	59	4.7e-15	54.6
TkA03G348850	`PF23564`	EF-hand_FSTL1	63	135	2.4e-05	25.4
TkA03G348850	`PF13833`	EF-hand_8	65	90	1.5e-09	38.2
TkA03G348850	`PF21008`	AIF-1	67	130	0.0015	19.5
TkA03G348850	`PF13499`	EF-hand_7	68	131	7.7e-13	49.3
TkA03G348850	`PF00036`	EF-hand_1	69	96	4.7e-15	54.6
TkA03G348850	`PF13405`	EF-hand_6	69	98	2.4e-13	49.2
TkA03G348850	`PF10591`	SPARC_Ca_bdg	70	129	0.00043	21.3
TkA03G348850	`PF13202`	EF-hand_5	71	94	6.1e-12	45.2
TkA03G348850	`PF14658`	EF-hand_9	72	133	0.0075	17.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9MBG5`	Arabidopsis thaliana	sp\|Q9MBG5\|CML45_ARATH Probable calcium-binding protein CML45	45.200%	Swiss-Prot	Medium
`Q93Z27`	Arabidopsis thaliana	sp\|Q93Z27\|CML46_ARATH Probable calcium-binding protein CML46	41.100%	Swiss-Prot	Medium
`Q9SN89`	Arabidopsis thaliana	sp\|Q9SN89\|CML47_ARATH Probable calcium-binding protein CML47	40.900%	Swiss-Prot	Low
`Q0DJ94`	Oryza sativa subsp. japonica	sp\|Q0DJ94\|CML21_ORYSJ Probable calcium-binding protein CML21	46.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card