TkA03G345220 | RubberDandelionOmics

Gene overview

TkA03G345220

Reference: TK1151 Chr: Chr03 Coordinates: 84969255-84970697 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

966 bp · TkA03G345220|TK1151|cDNA

TTAAGTGGCAAGGGTATTGGTGCAAAGGTTGACGCCGAGCAATATGCAAGTGATTTAATTGAACTCAGGGGTATAATTGATAATTCATATAGGAAGTTTCGCCCAAAATCATTACTCGTAGCACCCGGAGGGTTCTTTGATAAACAATGGTTTTCTAAGATGCTTCAAGTTTCTGGTTCAGAAATTGTCAATGTCATGACTCTCCATATATACAATCTAGGCCCAGGTGTTGATCCGAATTTAGTAAAAAAGATTTTAGA...

CDS

Download CDS FASTA

966 bp · TkA03G345220|TK1151|CDS

TTAAGTGGCAAGGGTATTGGTGCAAAGGTTGACGCCGAGCAATATGCAAGTGATTTAATTGAACTCAGGGGTATAATTGATAATTCATATAGGAAGTTTCGCCCAAAATCATTACTCGTAGCACCCGGAGGGTTCTTTGATAAACAATGGTTTTCTAAGATGCTTCAAGTTTCTGGTTCAGAAATTGTCAATGTCATGACTCTCCATATATACAATCTAGGCCCAGGTGTTGATCCGAATTTAGTAAAAAAGATTTTAGA...

Protein

Download Protein FASTA

322 aa · TkA03G345220|TK1151|PROTEIN

LSGKGIGAKVDAEQYASDLIELRGIIDNSYRKFRPKSLLVAPGGFFDKQWFSKMLQVSGSEIVNVMTLHIYNLGPGVDPNLVKKILDPHFLSRASITFSGLRETIETDGPWASFWVGESGGAYNSGGRHVSDTFVNSFWYLDQLAMAAKYHTKVYCRQTLLGGNYGLLNRTTFSPNPDYYSALLWDRLMGTGVLDVNRINIAPHLRTYAHCSKGKNGITVLLINLSNQTNFKLDVYNIMNLNLRTTQENTSRKNISFGDG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G345220`
TK1151 ID	TkA03G345220
OH-1004 ID	LXL04_008678
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 59.410 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G345220

Location Chr03:84969255-84970697 (-)

Description Similar to At5g07830: Heparanase-like protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g07830`	Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme.	No verified direct reference in this release
`At5g61250`	Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme.	No verified direct reference in this release
`At5g34940`	Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008678 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006029 proteoglycan metabolic process Biological Process

GO:0007160 cell-matrix adhesion Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010575 positive regulation of vascular endothelial growth factor production Biological Process

GO:0030200 heparan sulfate proteoglycan catabolic process Biological Process

GO:0030202 heparin proteoglycan metabolic process Biological Process

GO:0033690 positive regulation of osteoblast proliferation Biological Process

GO:0046677 response to antibiotic Biological Process

GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction Biological Process

GO:0071806 protein transmembrane transport Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

KEGG gene cross-reference

ag:BAA97804

ath:AT5G07830

ath:AT5G34940

ath:AT5G61250

hsa:10855

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.292

Rank 1 · TkA03G345220 · TK1151

Extracellular0.260

Rank 2 · TkA03G345220 · TK1151

Cytoplasm0.189

Rank 3 · TkA03G345220 · TK1151

Endoplasmic reticulum0.137

Rank 4 · TkA03G345220 · TK1151

Cell membrane0.092

Rank 5 · TkA03G345220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03662Glyco_hydro_79n1-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G345220	`PF03662`	Glyco_hydro_79n	1	144	3.4e-62	211.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FF10`	Arabidopsis thaliana	sp\|Q9FF10\|HPSE1_ARATH Heparanase-like protein 1	59.400%	Swiss-Prot	High
`Q8L608`	Arabidopsis thaliana	sp\|Q8L608\|HPSE2_ARATH Heparanase-like protein 2	56.500%	Swiss-Prot	High
`Q9FZP1`	Arabidopsis thaliana	sp\|Q9FZP1\|HPSE3_ARATH Heparanase-like protein 3	46.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card