TkA03G344720 | RubberDandelionOmics

Gene overview

TkA03G344720

Reference: TK1151 Chr: Chr03 Coordinates: 84814599-84814988 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

390 bp · TkA03G344720|TK1151|cDNA

ATGGCAGAGAGAAGGTTGTTGAACAAGTACTATCCGCCAGATTTTGATCCGGCGAAAATTCCACGGAGGAGAATCCCCAAGAATCAGCAAATCAAGGTTCGATTCATGCTTCCGATGAGCATTCGCTACAGCACTTGCGGAAACTATATCTACGAAGGAACAAAGTTCAATTCACGTAAAGAAGACGTGATTCATGATCGGTATGTAGGAATTCAGATATTTAGGTTCTATTTCAAATGTACTACTTGCTCATCTGAGAT...

CDS

Download CDS FASTA

390 bp · TkA03G344720|TK1151|CDS

ATGGCAGAGAGAAGGTTGTTGAACAAGTACTATCCGCCAGATTTTGATCCGGCGAAAATTCCACGGAGGAGAATCCCCAAGAATCAGCAAATCAAGGTTCGATTCATGCTTCCGATGAGCATTCGCTACAGCACTTGCGGAAACTATATCTACGAAGGAACAAAGTTCAATTCACGTAAAGAAGACGTGATTCATGATCGGTATGTAGGAATTCAGATATTTAGGTTCTATTTCAAATGTACTACTTGCTCATCTGAGAT...

Protein

Download Protein FASTA

129 aa · TkA03G344720|TK1151|PROTEIN

MAERRLLNKYYPPDFDPAKIPRRRIPKNQQIKVRFMLPMSIRYSTCGNYIYEGTKFNSRKEDVIHDRYVGIQIFRFYFKCTTCSSEITVKTDPQNSDYIVESGAARTFKPWRAEEEQNAKEMGDVYRDE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G344720`
TK1151 ID	TkA03G344720
OH-1004 ID	LXL04_008686
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	92.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G344720`
Location	Chr03:84814599-84814988 (+)
Description	Similar to Yju2: Splicing factor YJU2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008686` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000349 generation of catalytic spliceosome for first transesterification step Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:0000974 Prp19 complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005681 spliceosomal complex Cellular Component GO:0005684 U2-type spliceosomal complex Cellular Component GO:0071006 U2-type catalytic step 1 spliceosome Cellular Component GO:0046872 metal ion binding Molecular Function
KEGG gene cross-reference	ddi:DDB_G0279481 dre:393117 hsa:55702 mmu:72886 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.566

Rank 1 · TkA03G344720 · TK1151

Cytoplasm0.470

Rank 2 · TkA03G344720 · TK1151

Endoplasmic reticulum0.039

Rank 3 · TkA03G344720 · TK1151

Cell membrane0.027

Rank 4 · TkA03G344720 · TK1151

Plastid0.020

Rank 5 · TkA03G344720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04502Saf4_Yju29-121 aa

PF07255Benyvirus_14KDa58-107 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G344720	`PF04502`	Saf4_Yju2	9	121	9.9e-60	203.6
TkA03G344720	`PF07255`	Benyvirus_14KDa	58	107	0.1	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card