RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G344420
Reference: TK1151 Chr: Chr03 Coordinates: 84729493-84733237 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3114 bp · TkA03G344420|TK1151|cDNA

GCCCGCACTGCTTCAATTCCAGATGTCTCTCGTCGCCTTCAACATGTGTATAAAGCGTTTCGTCACTTCTCTCATCCATCAATTGGAAAAAATCTCCAAATACGTGAGTAAATTCGCACAAGCAAATCTTCATAGAAACGCACTCATACTCGCTAGTTCGAGTCGTTTGATTCTGATTGGTTTCGTACGCCGTTGAAGGAACATTTTAAGGTTTATACGAGTCATTATCCGAAATGAATCCCGACAAATTCACCCACAAG...

CDS

Download CDS FASTA

2286 bp · TkA03G344420|TK1151|CDS

ATGAATCCCGACAAATTCACCCACAAGACAAACGAGGCGTTGGCTTCAGGCCATGAACTCGCAATGAATGCCGGACACGCCCAATTCACACCGCTACATATTGCAGCAGCTCTAATCTCCGACCCTAACGGCATATTCCGGCAAGCAGTAAGCAATGCCGGCGGTGAAGAAGCAGGCAATTCAGCCGAGAGGGTTTTCAATCAAGCATTGAAGAAACTTCCTTCCCAGTCCCCTGCTCCTGACGAAGTTCCAGCAAGTAC...

Protein

Download Protein FASTA

761 aa · TkA03G344420|TK1151|PROTEIN

MNPDKFTHKTNEALASGHELAMNAGHAQFTPLHIAAALISDPNGIFRQAVSNAGGEEAGNSAERVFNQALKKLPSQSPAPDEVPASTSLIKTIRRAQSSQKSRGDTHLAVDQLILGLLEDSQISELLKESGVGASRVKSEVEKLRGKEGKKVESASGDTNFQALKTYGRDLVEQAGKLDPVIGRDEEIRRVIRILSRRTKNNPVLIGEPGVGKTAVVEGLAQRILRGDVPSNLADVRVVALDMGALIAGAKYRGEFEERL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G344420
TK1151 IDTkA03G344420
OH-1004 IDLXL04_008691
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.600
Protein coverage (%)TK1151 99.606 / OH-1004 83.114
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G344420
LocationChr03:84729493-84733237 (-)
DescriptionSimilar to CLPB1: Chaperone protein ClpB1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g74310 Molecular chaperone that plays an important role in thermotolerance.
Heat shock protein 101 plays a crucial role in thermotolerance in Arabidopsis.2000 · DOI: 10.1105/tpc.12.4.479
Mutants of Arabidopsis thaliana defective in the acquisition of tolerance to high temperature stress.2000 · DOI: 10.1073/pnas.97.8.4392
Hsp101 is necessary for heat tolerance but dispensable for development and germination in the absence of stress.2001 · DOI: 10.1046/j.1365-313x.2001.01066.x
Genetic analysis reveals domain interactions of Arabidopsis Hsp100/ClpB and cooperation with the small heat shock protein chaperone system.2005 · DOI: 10.1105/tpc.104.027540
The Arabidopsis ClpB/Hsp100 family of proteins: chaperones for stress and chloroplast development.2007 · DOI: 10.1111/j.1365-313x.2006.02940.x
Interplay between heat shock proteins HSP101 and HSA32 prolongs heat acclimation memory posttranscriptionally in Arabidopsis.2013 · DOI: 10.1104/pp.112.212589
An Arabidopsis heat shock protein complements a thermotolerance defect in yeast.1994 · DOI: 10.1105/tpc.6.12.1899
At4g14670 Putative chaperone protein ClpB2, chloroplastic. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os05g0519700 Molecular chaperone involved in heat stress response.
Molecular characterization of rice hsp101: complementation of yeast hsp104 mutation by disaggregation of protein granules and differential expression in indica and japonica rice types.2003 · DOI: 10.1023/a:1022324920316
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_008691 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009408 response to heat Biological Process
GO:0009644 response to high light intensity Biological Process
GO:0034605 cellular response to heat Biological Process
GO:0042026 protein refolding Biological Process
GO:0043335 protein unfolding Biological Process
GO:0045727 positive regulation of translation Biological Process
GO:0071456 cellular response to hypoxia Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005829 cytosol Cellular Component
GO:0009570 chloroplast stroma Cellular Component
GO:0009941 chloroplast envelope Cellular Component
KEGG gene cross-reference
ath:AT1G74310
dosa:Os05g0519700
dvu:DVU_1874
gvi:gll3577
syf:Synpcc7942_1089
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.596
Rank 1 · TkA03G344420 · TK1151
Nucleus0.370
Rank 2 · TkA03G344420 · TK1151
Cell membrane0.089
Rank 3 · TkA03G344420 · TK1151
Mitochondrion0.088
Rank 4 · TkA03G344420 · TK1151
Endoplasmic reticulum0.057
Rank 5 · TkA03G344420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02861Clp_N5-129 aa
PF01935DUF8789-144 aa
PF02861Clp_N117-155 aa
PF03193RsgA_GTPase117-154 aa
PF13191AAA_16181-232 aa
PF00158Sigma54_activat182-282 aa
PF20030bpMoxR182-224 aa
PF25201nSTAND6182-228 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G344420PF02861Clp_N51298.1e-2897.9
TkA03G344420PF01935DUF87891440.04214.7
TkA03G344420PF02861Clp_N1171558.1e-2897.9
TkA03G344420PF03193RsgA_GTPase1171540.005117.4
TkA03G344420PF13191AAA_161812321.3e-1042.8
TkA03G344420PF00158Sigma54_activat1822821.1e-0938.9
TkA03G344420PF20030bpMoxR1822241.3e-0525.1
TkA03G344420PF25201nSTAND61822280.0003421.4
TkA03G344420PF01637ATPase_21842812.4e-0524.9
TkA03G344420PF23569NBD_SMAX11852871.6e-0938.6
TkA03G344420PF02367TsaE1872300.0001922.1
TkA03G344420PF12780AAA_81872820.09412.7
TkA03G344420PF20720nSTAND31892261.6e-0731.9
TkA03G344420PF01078Mg_chelatase1892210.000520.2
TkA03G344420PF04851ResIII1902250.003717.9
TkA03G344420PF05673DUF8151922800.0005419.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
P42730Arabidopsis thalianasp|P42730|CLPB1_ARATH Chaperone protein ClpB186.000%Swiss-ProtHigh
F4JVJ1Arabidopsis thalianasp|F4JVJ1|CLPB2_ARATH Putative chaperone protein ClpB2, chloroplastic66.800%Swiss-ProtHigh
Q6F2Y7Oryza sativa subsp. japonicasp|Q6F2Y7|CLPB1_ORYSJ Chaperone protein ClpB184.900%Swiss-ProtHigh

JBrowse

View in Genome Browser