TkA03G343890 | RubberDandelionOmics

Gene overview

TkA03G343890

Reference: TK1151 Chr: Chr03 Coordinates: 84586255-84588158 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1506 bp · TkA03G343890|TK1151|cDNA

TTTCGCAATTTATTATGTAAAGTTTGAGGGTTTTACTATATAAGTCCTTGAGAAATCAGGATAATAAATCAATGCAAAAAACAGCAGAAATGGCCTCCTTCATCCACTGGCTTCCATTCCTGCTGATTCTCGCCGCTGCCCGCAAACCTCACGTTCCCAGAACCTTCAATGTCTTGTCTTATGGTGCACTTCCCAGTCGAAACACCGATAACAGCAAGGCATTTCTTCGAGCATGGAAGGATGCCTGTGAACGGGAGGGC...

CDS

Download CDS FASTA

1200 bp · TkA03G343890|TK1151|CDS

ATGCAAAAAACAGCAGAAATGGCCTCCTTCATCCACTGGCTTCCATTCCTGCTGATTCTCGCCGCTGCCCGCAAACCTCACGTTCCCAGAACCTTCAATGTCTTGTCTTATGGTGCACTTCCCAGTCGAAACACCGATAACAGCAAGGCATTTCTTCGAGCATGGAAGGATGCCTGTGAACGGGAGGGCGGAGGTAGGGTTTGGATCCCGAGAGGGAAGTTCAAGCTCGGTTTCGTCGTCTTCGTCGGACCTTGTAGGGG...

Protein

Download Protein FASTA

399 aa · TkA03G343890|TK1151|PROTEIN

MQKTAEMASFIHWLPFLLILAAARKPHVPRTFNVLSYGALPSRNTDNSKAFLRAWKDACEREGGGRVWIPRGKFKLGFVVFVGPCRGPVDFVIKGSLEASTDPSNFFVDHWIGFKYVDQLVVRGGGYLLGNGGSAWRFNDCATNSRCKPLPVTMRFDFVSNSKVHRIHSFDSKNAHFNLFACHNMNMSHIQILAPSTSPNTDGIRIGSSSNIRIQNSVISTGDDCVSMIAGSQDILVSEVHCGPGHGFSIGSLGGSHNEE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G343890`
TK1151 ID	TkA03G343890
OH-1004 ID	LXL04_008706
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G343890

Location Chr03:84586255-84588158 (-)

Description Similar to plaa2: Exopolygalacturonase (Fragment)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07850`	May function in depolymerizing pectin during pollen development, germination, and tube growth.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008706 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009555 pollen development Biological Process

GO:0009846 pollen germination Biological Process

GO:0045490 pectin catabolic process Biological Process

GO:0048868 pollen tube development Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0031982 vesicle Cellular Component

GO:0043667 pollen wall Cellular Component

GO:0004650 polygalacturonase activity Molecular Function

KEGG gene cross-reference

bna:106427912

ghi:107942091

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.796

Rank 1 · TkA03G343890 · TK1151

Cell membrane0.057

Rank 2 · TkA03G343890 · TK1151

Cytoplasm0.054

Rank 3 · TkA03G343890 · TK1151

Lysosome / Vacuole0.043

Rank 4 · TkA03G343890 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA03G343890 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12708Pect-lyase_RHGA_epim32-74 aa

PF00295Glyco_hydro_2859-387 aa

PF12708Pect-lyase_RHGA_epim115-146 aa

PF13229Beta_helix141-235 aa

PF05048NosD174-269 aa

PF12708Pect-lyase_RHGA_epim187-285 aa

PF13229Beta_helix201-313 aa

PF12708Pect-lyase_RHGA_epim321-346 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G343890	`PF12708`	Pect-lyase_RHGA_epim	32	74	1.5e-07	32.2
TkA03G343890	`PF00295`	Glyco_hydro_28	59	387	1.8e-97	327.0
TkA03G343890	`PF12708`	Pect-lyase_RHGA_epim	115	146	1.5e-07	32.2
TkA03G343890	`PF13229`	Beta_helix	141	235	1.1	9.5
TkA03G343890	`PF05048`	NosD	174	269	0.55	10.3
TkA03G343890	`PF12708`	Pect-lyase_RHGA_epim	187	285	1.5e-07	32.2
TkA03G343890	`PF13229`	Beta_helix	201	313	1.1	9.5
TkA03G343890	`PF12708`	Pect-lyase_RHGA_epim	321	346	1.5e-07	32.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49063`	Arabidopsis thaliana	sp\|P49063\|PGLR2_ARATH Exopolygalacturonase	42.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card