TkA03G336790 | RubberDandelionOmics

Gene overview

TkA03G336790

Reference: TK1151 Chr: Chr03 Coordinates: 82881078-82883990 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1532 bp · TkA03G336790|TK1151|cDNA

ATATAACCCGTTGGCCCTTTCGATAGTCTGATTCCAGTGAGCAGCCACCGATAATAAACTGGTGGAACTGTGGAAGAGACCTAACACCTGCGATCAGGAAGGTGTTGTTACCCTCTAAGTTTGCTCCTCCGGCAGTGACTTCGATCAGATGGATATGACAGAAGGAACACCTGCTCTCCATGGATTCCGAATGCCCGCAGAATGGGAACCCCATTCTCAAACCTGGCTTGGTTGGCCCGAACGTCCTGATAATTGGCGAG...

CDS

Download CDS FASTA

1125 bp · TkA03G336790|TK1151|CDS

ATGGATATGACAGAAGGAACACCTGCTCTCCATGGATTCCGAATGCCCGCAGAATGGGAACCCCATTCTCAAACCTGGCTTGGTTGGCCCGAACGTCCTGATAATTGGCGAGATAACGGAGTCCATGGCCAGAGTATTTTCGCAAAAGTTGCCTCCGCTATTTCCAAGTTCGAGCCTGTCACTGTTTGCGCCAGTGCCTCTCAGTGGGCAAACGCACGTGATCAATTGCCTCATAATGTGAGGGTTGTTGAGATGAGTAT...

Protein

Download Protein FASTA

374 aa · TkA03G336790|TK1151|PROTEIN

MDMTEGTPALHGFRMPAEWEPHSQTWLGWPERPDNWRDNGVHGQSIFAKVASAISKFEPVTVCASASQWANARDQLPHNVRVVEMSMNDSWFRDSGPTFVVNEGKSASGHNVAGIDWNFNSWGGVDDGCYIDWSHDLLVAQKILSIERVPRFQHSMILEGGSIHVDGEGTCLTTEECLLNKNRNPHLNKQQIEDELRAYLGVNKIIWLPRGLFGDDDTNGHIDNMCCFVKPGVVLLSWTNDESDPHYERAIEAYNVLSNS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G336790`
TK1151 ID	TkA03G336790
OH-1004 ID	LXL04_008760
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G336790

Location Chr03:82881078-82883990 (+)

Description Similar to AIH: Agmatine deiminase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g08170`	Mediates the hydrolysis of agmatine into N-carbamoylputrescine in the arginine decarboxylase (ADC) pathway of putrescine biosynthesis, a basic polyamine.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008760 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006596 polyamine biosynthetic process Biological Process

GO:0033388 putrescine biosynthetic process from arginine Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0004668 protein-arginine deiminase activity Molecular Function

GO:0047632 agmatine deiminase activity Molecular Function

KEGG gene cross-reference

ath:AT5G08170

mtr:11445422

pap:PSPA7_0383

ppf:Pput_0281

ppg:PputGB1_0291

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.726

Rank 1 · TkA03G336790 · TK1151

Nucleus0.318

Rank 2 · TkA03G336790 · TK1151

Mitochondrion0.095

Rank 3 · TkA03G336790 · TK1151

Plastid0.087

Rank 4 · TkA03G336790 · TK1151

Peroxisome0.062

Rank 5 · TkA03G336790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04371PAD_porph14-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G336790	`PF04371`	PAD_porph	14	369	9.4e-130	433.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWW7`	Arabidopsis thaliana	sp\|Q8GWW7\|AGUA_ARATH Agmatine deiminase	72.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card