TkA03G326730 | RubberDandelionOmics

Gene overview

TkA03G326730

Reference: TK1151 Chr: Chr03 Coordinates: 80301753-80309846 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1524 bp · TkA03G326730|TK1151|cDNA

TTTACTTTGATCGAACAATGGATTCTTTTACTTGCTCAAAGTCAACGAATTCAGATTCATCATATTTATCATATTTAACCCATTCTTCGCCGGTTCTCCCCCTTCCCACTCAACTTTCATACTACCTTTCATCCTCATCATCTCTAGAGTTCCAGAGAATGGCCGTGCAATGGCTTTTGGTGTGCCATGGACTGGTAACGCTGTTGGTCGTCGTATCTTTTCTGTGCGGCCAGTGGCCAATATTTCAAGGCACTTTCATC...

CDS

Download CDS FASTA

1323 bp · TkA03G326730|TK1151|CDS

ATGGATTCTTTTACTTGCTCAAAGTCAACGAATTCAGATTCATCATATTTATCATATTTAACCCATTCTTCGCCGGTTCTCCCCCTTCCCACTCAACTTTCATACTACCTTTCATCCTCATCATCTCTAGAGTTCCAGAGAATGGCCGTGCAATGGCTTTTGGTGTGCCATGGACTGGTAACGCTGTTGGTCGTCGTATCTTTTCTGTGCGGCCAGTGGCCAATATTTCAAGGCACTTTCATCCAACGCATTCACACTTT...

Protein

Download Protein FASTA

440 aa · TkA03G326730|TK1151|PROTEIN

MDSFTCSKSTNSDSSYLSYLTHSSPVLPLPTQLSYYLSSSSSLEFQRMAVQWLLVCHGLVTLLVVVSFLCGQWPIFQGTFIQRIHTFLTFGAFDYFRRFIEFVFGSRGTNALYLTQYYCCDRPNPILQGMYLAIVGGTYGLIVYTTFSYIPGVYISGYHRYTSLLAVGVGFLLFLLASFSDPGTVNSKNVSQYLSLYPYDNIIYSEKECSTCKILKPARSKHCSICDRCVARFDHHCGWMNNCIGEKNTLYFVMFLFWHF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G326730`
TK1151 ID	TkA03G326730
OH-1004 ID	LXL04_007498
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.700
Protein coverage (%)	TK1151 89.318 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G326730

Location Chr03:80301753-80309846 (+)

Description Similar to PAT17: Probable protein S-acyltransferase 17

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g04970`	Palmitoyl acyltransferase.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0363900`	Palmitoyltransferase involved in the positive regulation of salt and oxidative stress tolerance.	The zinc finger protein DHHC09 S-acylates the kinase STRK1 to regulate H2O2 homeostasis and promote salt tolerance in rice.2024 · DOI: 10.1093/plcell/koae001

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007498 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:1901002 positive regulation of response to salt stress Biological Process

GO:1902884 positive regulation of response to oxidative stress Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0019706 protein-cysteine S-palmitoyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT3G04970

dre:561817

ncr:NCU04080

osa:4332904

spo:2539719

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.497

Rank 1 · TkA03G326730 · TK1151

Golgi apparatus0.281

Rank 2 · TkA03G326730 · TK1151

Cytoplasm0.137

Rank 3 · TkA03G326730 · TK1151

Nucleus0.123

Rank 4 · TkA03G326730 · TK1151

Cell membrane0.085

Rank 5 · TkA03G326730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18181SLATT_131-90 aa

PF01529DHHC52-70 aa

PF09796QCR1061-84 aa

PF01529DHHC103-103 aa

PF09796QCR10129-153 aa

PF01529DHHC205-353 aa

PF18181SLATT_1258-283 aa

PF28216DVU0150298-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G326730	`PF18181`	SLATT_1	31	90	1.7	9.4
TkA03G326730	`PF01529`	DHHC	52	70	4.1e-36	124.7
TkA03G326730	`PF09796`	QCR10	61	84	0.35	11.6
TkA03G326730	`PF01529`	DHHC	103	103	4.1e-36	124.7
TkA03G326730	`PF09796`	QCR10	129	153	0.35	11.6
TkA03G326730	`PF01529`	DHHC	205	353	4.1e-36	124.7
TkA03G326730	`PF18181`	SLATT_1	258	283	1.7	9.4
TkA03G326730	`PF28216`	DVU0150	298	339	0.33	11.9
TkA03G326730	`PF18181`	SLATT_1	313	394	1.7	9.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3EBC2`	Arabidopsis thaliana	sp\|Q3EBC2\|ZDHC5_ARATH Probable protein S-acyltransferase 17	59.900%	Swiss-Prot	High
`Q10L01`	Oryza sativa subsp. japonica	sp\|Q10L01\|ZDHC9_ORYSJ Protein S-acyltransferase DHHC9	65.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card