TkA03G325880 | RubberDandelionOmics

Gene overview

TkA03G325880

Reference: TK1151 Chr: Chr03 Coordinates: 80050171-80055155 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2525 bp · TkA03G325880|TK1151|cDNA

ATAAGAACACGCGGATCCTCATGAACCCATGGGTTGATTTGACCCGGATATATAACGTGCATCTTGCTCCCTCTCTTTTTCTCTCTCAGCCTAACCCCACGACTGTGCTTGCAAAACGCCACCACCACACACCGACCAACCTTCGCACCTTCACCACCACTCCCGTCTTACTACTTTTTCAGGCGTTGGACGCAAGAGGCTCGCCTCCGACAGTGCGATTGATGGCCTTTGTGGTGCTGCTGCTGTTCTCGGTGGTTTGA...

CDS

Download CDS FASTA

1743 bp · TkA03G325880|TK1151|CDS

ATGCCCAACTCTAGACGACAGAAGAAGGGCCATGGGGACCGGAAACAAAAAAATCAAAGTGCGGGTGGTGGTAAAAGGCCGAAAGACGATGAAAACGGCCCTTCACATATGGAGATCAGTCGACCTCTTTCAGCACAGATGCCGGCTTTTGTTCAGTATAAATGTGGGCATACAAGCGCTGAGCCTTTAAAGCACACTGTTGATATCTTGGTTAGAACCGTGAAGTTTGTGCTCGTTCAAAGGAAACCTAAAGATGGCTT...

Protein

Download Protein FASTA

580 aa · TkA03G325880|TK1151|PROTEIN

MPNSRRQKKGHGDRKQKNQSAGGGKRPKDDENGPSHMEISRPLSAQMPAFVQYKCGHTSAEPLKHTVDILVRTVKFVLVQRKPKDGLNEGCIEFECVPYVDGSITLEFSEMVLGSPGSSPTKNVLDSIPLDLTQELSKKLMCVPIKFPINTIRLKEPYKVEIKTEAKQVTNGLNVCQLTLAVIEKMNGEFLIRVTDQIVWVNERPFFCHDRTGIFKALNIDNKKSDPQCGRCLVINNPGILDPIGNISVTSEIGRGSNTT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G325880`
TK1151 ID	TkA03G325880
OH-1004 ID	LXL04_007505
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	79.500
Protein coverage (%)	TK1151 82.759 / OH-1004 90.782 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G325880`
Location	Chr03:80050171-80055155 (+)
Description	Similar to IRE1A: Serine/threonine-protein kinase/endoribonuclease IRE1a
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007505` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation Biological Process GO:0002376 immune system process Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006397 mRNA processing Biological Process GO:0006914 autophagy Biological Process GO:0006986 response to unfolded protein Biological Process GO:0008380 RNA splicing Biological Process GO:0009751 response to salicylic acid Biological Process GO:0010628 positive regulation of gene expression Biological Process GO:0030968 endoplasmic reticulum unfolded protein response Biological Process GO:0034263 positive regulation of autophagy in response to ER overload Biological Process GO:0034976 response to endoplasmic reticulum stress Biological Process
KEGG gene cross-reference	ath:AT2G17520 ath:AT3G11870 ath:AT5G24360 dosa:Os07g0471000 spo:2542776 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.514

Rank 1 · TkA03G325880 · TK1151

Nucleus0.398

Rank 2 · TkA03G325880 · TK1151

Cell membrane0.122

Rank 3 · TkA03G325880 · TK1151

Mitochondrion0.073

Rank 4 · TkA03G325880 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA03G325880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26192RNF157-like_N161-203 aa

PF07714PK_Tyr_Ser-Thr248-412 aa

PF00069Pkinase249-339 aa

PF00069Pkinase369-411 aa

PF25013LRR_Zer-1374-421 aa

PF13206VSG_B462-510 aa

PF00069Pkinase475-515 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G325880	`PF26192`	RNF157-like_N	161	203	5.9e-05	24.1
TkA03G325880	`PF07714`	PK_Tyr_Ser-Thr	248	412	8.2e-13	49.0
TkA03G325880	`PF00069`	Pkinase	249	339	3.6e-18	66.6
TkA03G325880	`PF00069`	Pkinase	369	411	3.6e-18	66.6
TkA03G325880	`PF25013`	LRR_Zer-1	374	421	0.21	12.4
TkA03G325880	`PF13206`	VSG_B	462	510	0.21	11.5
TkA03G325880	`PF00069`	Pkinase	475	515	3.6e-18	66.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card