RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G325420
Reference: TK1151 Chr: Chr03 Coordinates: 79931674-79933274 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1117 bp · TkA03G325420|TK1151|cDNA

TTGAATTTTGCTTGCTTCCTGTCGAATTTTGCAAATGCATCGAATAGGCACAGCACTCTTCACCTATTTCATCTACATCTACTGTGAAATCTCAATACTGGTGTCTGAACTAAAAAGCAGATTTTCTGAAATGAAATTTTCCACTGGAATAATATCACAAGCTAGTGTTGAATCTACTGTTTTAGATATTTGGCCATGGAGAAATCGAGGGAAAATTAGATTCACGATTAGATTATGCTCCGCTAAGTGCTATGTACTAG...

CDS

Download CDS FASTA

303 bp · TkA03G325420|TK1151|CDS

ATGCATCGAATAGGCACAGCACTCTTCACCTATTTCATCTACATCTACTGTGAAATCTCAATACTGGTGTCTGAACTAAAAAGCAGATTTTCTGAAATGAAATTTTCCACTGGAATAATATCACAAGCTAGTGTTGAATCTACTGTTTTAGATATTTGGCCATGGAGAAATCGAGGGAAAATTAGATTCACGATTAGATTATGCTCCGCTAAGTGCTATGTACTAGTTGCTTTTCATATCTATTTTCGTTACGCATATTT...

Protein

Download Protein FASTA

100 aa · TkA03G325420|TK1151|PROTEIN

MHRIGTALFTYFIYIYCEISILVSELKSRFSEMKFSTGIISQASVESTVLDIWPWRNRGKIRFTIRLCSAKCYVLVAFHIYFRYAYFSEFDRFESVTPLI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G325420
TK1151 IDTkA03G325420
OH-1004 IDLXL04_007513
Relationship / confidenceSequence Supported Annotation Or Model Conflict / Review
Protein identity (%)97.800
Protein coverage (%)TK1151 91.000 / OH-1004 31.058
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G325420
LocationChr03:79931674-79933274 (-)
DescriptionSimilar to ARL2: ADP-ribosylation factor-like protein 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_007513 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000226 microtubule cytoskeleton organization Biological Process
GO:0006110 regulation of glycolytic process Biological Process
GO:0006457 protein folding Biological Process
GO:0007021 tubulin complex assembly Biological Process
GO:0007098 centrosome cycle Biological Process
GO:0009558 embryo sac cellularization Biological Process
GO:0009793 embryo development ending in seed dormancy Biological Process
GO:0009960 endosperm development Biological Process
GO:0010811 positive regulation of cell-substrate adhesion Biological Process
GO:0015870 acetylcholine transport Biological Process
GO:0031113 regulation of microtubule polymerization Biological Process
GO:0031116 positive regulation of microtubule polymerization Biological Process
KEGG gene cross-reference
ath:AT2G18390
bta:511349
hsa:402
mmu:56327
rno:65142
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.402
Rank 1 · TkA03G325420 · TK1151
Nucleus0.312
Rank 2 · TkA03G325420 · TK1151
Mitochondrion0.221
Rank 3 · TkA03G325420 · TK1151
Cell membrane0.103
Rank 4 · TkA03G325420 · TK1151
Endoplasmic reticulum0.093
Rank 5 · TkA03G325420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser