TkA03G322630 | RubberDandelionOmics

Gene overview

TkA03G322630

Reference: TK1151 Chr: Chr03 Coordinates: 79383098-79385385 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

559 bp · TkA03G322630|TK1151|cDNA

TTTCACGTTTACAGTAACTCTTACCCTTTCTGGAAACAATTCCTCCTCGCTTTCTTCTTGTTTCCGTCCATTACTCTCTTTCTCTCTCACACACACATATCGGAGCTACCAAAAACATCTCGGATAAACAGCAATTGCGAAAATGGCGAGGGGAAAGATCCAGATCAAGAAGATAGAGAACTCAACCAACAGGCAGGTCACGTATTCCAAGAGGAGGAATGGATTGTTCAAGAAGGCGAGTGAACTCACGGTGTTGTGCG...

CDS

Download CDS FASTA

417 bp · TkA03G322630|TK1151|CDS

ATGGCGAGGGGAAAGATCCAGATCAAGAAGATAGAGAACTCAACCAACAGGCAGGTCACGTATTCCAAGAGGAGGAATGGATTGTTCAAGAAGGCGAGTGAACTCACGGTGTTGTGCGATGCTAAAGTCTCCATTATCATGGTCTCTTGTACTGATAAGCTTCATGAGTACATAAGTCCTTCCATCACGACGAAGCAGTTCTTCGATCAGTATCAGACGACATCTGGAATTGACCTTTGGAACTCCCACTACGAGAAAAT...

Protein

Download Protein FASTA

139 aa · TkA03G322630|TK1151|PROTEIN

MARGKIQIKKIENSTNRQVTYSKRRNGLFKKASELTVLCDAKVSIIMVSCTDKLHEYISPSITTKQFFDQYQTTSGIDLWNSHYEKMQEEMRQLKEVNKNLRRQIRQRLGDCLEHLGFEELLDLEKESQEAVYIIRERK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G322630`
TK1151 ID	TkA03G322630
OH-1004 ID	LXL04_008837
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 61.233 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G322630

Location Chr03:79383098-79385385 (-)

Description Similar to DEFA: Floral homeotic protein DEFICIENS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54340`	Probable transcription factor involved in the genetic control of flower development.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008837 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009908 flower development Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0030154 cell differentiation Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048437 floral organ development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding Molecular Function

GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding Molecular Function

GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

KEGG gene cross-reference

ath:AT3G54340

vvi:100233014

vvi:100233029

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.902

Rank 1 · TkA03G322630 · TK1151

Cytoplasm0.192

Rank 2 · TkA03G322630 · TK1151

Cell membrane0.017

Rank 3 · TkA03G322630 · TK1151

Mitochondrion0.011

Rank 4 · TkA03G322630 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA03G322630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF10-57 aa

PF01486K-box11-18 aa

PF28859SPCC191_0113-25 aa

PF05812Herpes_BLRF216-34 aa

PF13905Thioredoxin_837-58 aa

PF14176YxiJ38-99 aa

PF13902R3H-assoc59-104 aa

PF15764DUF469363-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G322630	`PF00319`	SRF-TF	10	57	7.3e-25	86.9
TkA03G322630	`PF01486`	K-box	11	18	6.3e-12	46.2
TkA03G322630	`PF28859`	SPCC191_01	13	25	0.72	10.9
TkA03G322630	`PF05812`	Herpes_BLRF2	16	34	0.16	12.8
TkA03G322630	`PF13905`	Thioredoxin_8	37	58	0.067	14.3
TkA03G322630	`PF14176`	YxiJ	38	99	0.056	14.8
TkA03G322630	`PF13902`	R3H-assoc	59	104	0.033	15.3
TkA03G322630	`PF15764`	DUF4693	63	114	0.036	14.3
TkA03G322630	`PF05596`	Taeniidae_ag	64	69	0.31	11.6
TkA03G322630	`PF28859`	SPCC191_01	65	70	0.72	10.9
TkA03G322630	`PF13905`	Thioredoxin_8	76	102	0.067	14.3
TkA03G322630	`PF01486`	K-box	81	139	6.3e-12	46.2
TkA03G322630	`PF05812`	Herpes_BLRF2	83	114	0.16	12.8
TkA03G322630	`PF09409`	PUB	84	133	0.023	15.3
TkA03G322630	`PF05596`	Taeniidae_ag	86	116	0.31	11.6
TkA03G322630	`PF28859`	SPCC191_01	89	124	0.72	10.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P35632`	Arabidopsis thaliana	sp\|P35632\|AP3_ARATH Floral homeotic protein APETALA 3	66.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card