TkA03G317610 | RubberDandelionOmics

Gene overview

TkA03G317610

Reference: TK1151 Chr: Chr03 Coordinates: 77978967-77981308 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1156 bp · TkA03G317610|TK1151|cDNA

GTAAAATCGCCTTAAGTTTGAAATATTTAAAACATGAAATGAGATAAACGTGCTGAGATATGTGAACATGATTTGAAAACCGGAAAGAAAGAAGAAGAAGAAGGAATTGGATGCGGAATGTTAATGCAATAACCTTTTATTATAGAAGTGAACAGAGTAGGGATTAAGGACATATGTCCTTTGAAGGACAACTGTTGGTAAAGGAAATGGAAATATGAAGCCAAGTCAAGCCAAAGTTTTTTCACTCTTCATAGAGCGGG...

CDS

Download CDS FASTA

432 bp · TkA03G317610|TK1151|CDS

ATGAGCAAGAAAGAATTAGTAAAGTGGACAGACTGGATGGACGAATGTTTTATTCAATCCCTGTTAACACAACAAGATAAAGGCAATAGGATTAATGGGACATTTACTTCACAAGCATACGCTAATATGGTGGAGGAATTGAATGCCAAAACTGGGTTGAATTTAACAAAAAGCCATTTAAAGAACCGTATGAAAACTTTAAAAAATTCTTTTTTACAATGGTATGACATGTTTCGTGGAACTTCATTGAGTGGATTTGG...

Protein

Download Protein FASTA

143 aa · TkA03G317610|TK1151|PROTEIN

MSKKELVKWTDWMDECFIQSLLTQQDKGNRINGTFTSQAYANMVEELNAKTGLNLTKSHLKNRMKTLKNSFLQWYDMFRGTSLSGFGWNSETHLIEADDEVWANLINSKPEAISLKTKKVSHYNEMLALFARDRASGNNRVLV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G317610`
TK1151 ID	TkA03G317610
OH-1004 ID	LXL04_013222
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	95.100
Protein coverage (%)	TK1151 100.000 / OH-1004 97.279 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G317610`
Location	Chr03:77978967-77981308 (+)
Description	Similar to LIMYB: L10-interacting MYB domain-containing protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_013222` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0005634 nucleus Cellular Component GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific Molecular Function
KEGG gene cross-reference	ath:AT5G05800 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.897

Rank 1 · TkA03G317610 · TK1151

Cytoplasm0.180

Rank 2 · TkA03G317610 · TK1151

Mitochondrion0.028

Rank 3 · TkA03G317610 · TK1151

Extracellular0.023

Rank 4 · TkA03G317610 · TK1151

Cell membrane0.020

Rank 5 · TkA03G317610 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12776Myb_DNA-bind_38-104 aa

PF13837Myb_DNA-bind_48-73 aa

PF03288Pox_D517-69 aa

PF12776Myb_DNA-bind_3121-132 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G317610	`PF12776`	Myb_DNA-bind_3	8	104	2.2e-24	87.0
TkA03G317610	`PF13837`	Myb_DNA-bind_4	8	73	0.0025	18.9
TkA03G317610	`PF03288`	Pox_D5	17	69	0.083	14.1
TkA03G317610	`PF12776`	Myb_DNA-bind_3	121	132	2.2e-24	87.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card