TkA03G317050 | RubberDandelionOmics

Gene overview

TkA03G317050

Reference: TK1151 Chr: Chr03 Coordinates: 77818139-77819755 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1530 bp · TkA03G317050|TK1151|cDNA

ATGACGAAGTTCTCCACTTGTCTCCTTTTGGTCGTGATTATCCTCGTCCATGCACCGGTATGTCCTGCTGCAGGCGGATCATGGTCGGTCCTCCTCCCAAGCATCGGCATCTCCGCCATGCACATGCAGCTTCTCCCGAACGACCGTGTTGTAATGTACGATCGTACAGATTTTGGCACTTCAAACATCTCTCTTCCAAATGGAAAATGCCGGCCCAACTCAACCGACTGCTCGGCTCATTCGGTGGAGTATGATGTTGG...

CDS

Download CDS FASTA

1530 bp · TkA03G317050|TK1151|CDS

ATGACGAAGTTCTCCACTTGTCTCCTTTTGGTCGTGATTATCCTCGTCCATGCACCGGTATGTCCTGCTGCAGGCGGATCATGGTCGGTCCTCCTCCCAAGCATCGGCATCTCCGCCATGCACATGCAGCTTCTCCCGAACGACCGTGTTGTAATGTACGATCGTACAGATTTTGGCACTTCAAACATCTCTCTTCCAAATGGAAAATGCCGGCCCAACTCAACCGACTGCTCGGCTCATTCGGTGGAGTATGATGTTGG...

Protein

Download Protein FASTA

509 aa · TkA03G317050|TK1151|PROTEIN

MTKFSTCLLLVVIILVHAPVCPAAGGSWSVLLPSIGISAMHMQLLPNDRVVMYDRTDFGTSNISLPNGKCRPNSTDCSAHSVEYDVGANTDDGYRRVRSYKSCGTCDWKEIPNGLRKQRWYATNHLLPDGRQIIIGGRQAFNYEFYPKKSATENSPSFPFLVQTNDPNVENNLYPFVFLNPDGNLFVFANNRAILFDYSKNQVVKTYPTMPGGQPRSYPSTGSAVLLPLWIKKGMVDVVEVLVCGGAPKGAFVNANNGKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G317050`
TK1151 ID	TkA03G317050
OH-1004 ID	LXL04_008809
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	92.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G317050

Location Chr03:77818139-77819755 (+)

Description Similar to GLOX1: Aldehyde oxidase GLOX1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g67290`	Catalyzes the oxidation of aldehydes to the corresponding carboxylate by coupling the reaction to the reduction of dioxygen to hydrogen peroxide.	The MYB80 transcription factor is required for pollen development and the regulation of tapetal programmed cell death in Arabidopsis thaliana.2011 · DOI: 10.1105/tpc.110.082651

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008809 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0050665 hydrogen peroxide biosynthetic process Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005615 extracellular space Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0004031 aldehyde oxidase activity Molecular Function

KEGG gene cross-reference

abe:ARB_07867

ag:AAA33747

ath:AT1G67290

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.916

Rank 1 · TkA03G317050 · TK1151

Cytoplasm0.036

Rank 2 · TkA03G317050 · TK1151

Cell membrane0.034

Rank 3 · TkA03G317050 · TK1151

Endoplasmic reticulum0.021

Rank 4 · TkA03G317050 · TK1151

Lysosome / Vacuole0.016

Rank 5 · TkA03G317050 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07250Glyoxal_oxid_N40-90 aa

PF07250Glyoxal_oxid_N91-392 aa

PF13415Beta-prop_FBX42116-142 aa

PF13415Beta-prop_FBX42281-308 aa

PF13415Beta-prop_FBX42336-370 aa

PF09118GO-like_E_set401-507 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G317050	`PF07250`	Glyoxal_oxid_N	40	90	7.5e-157	522.6
TkA03G317050	`PF07250`	Glyoxal_oxid_N	91	392	7.5e-157	522.6
TkA03G317050	`PF13415`	Beta-prop_FBX42	116	142	0.09	13.1
TkA03G317050	`PF13415`	Beta-prop_FBX42	281	308	0.09	13.1
TkA03G317050	`PF13415`	Beta-prop_FBX42	336	370	0.09	13.1
TkA03G317050	`PF09118`	GO-like_E_set	401	507	2.2e-29	102.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FYG4`	Arabidopsis thaliana	sp\|Q9FYG4\|GLOX1_ARATH Aldehyde oxidase GLOX1	43.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card