TkA03G315230 | RubberDandelionOmics

Gene overview

TkA03G315230

Reference: TK1151 Chr: Chr03 Coordinates: 77421291-77422848 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1233 bp · TkA03G315230|TK1151|cDNA

TTTGTAGATATTTTCAAATTCTAAAATATAGGTTGCCTTATCAAAAAACAATAATCATGCTAATATATGGTTGCGGGTCGGTTTGTTTCAACACCCGGAGTCATACAAAACCACTGGAGTAAAAGCGCGAAGAACCCTAAAACAACAAATTTCTCTAGATTGGGTGTGATCGATTCACGTGTTATCTTTCAATAATTAGGACTCGCCCTCTTCCATTTCGCTTGATAAATGCATCTGCAAAGGGGTAAACTGCTATTTGT...

CDS

Download CDS FASTA

582 bp · TkA03G315230|TK1151|CDS

ATGGAAGGATCAGGGGGTGATTCTGCCTCCCCAATGGCACCAGTAGCAAAGTGGAAAACTGAATTCTCGAGGGTGTTTCAATTTTATCTGGACAAATCTTCTCCACTTCTTGTTCATAGGTGGCTTGGGACGCTTGGAGTTGCAGCAATTTATGTGTTGAGGGTCTATTATCTCGAAGGGTTTTACATTATCTCTTACGGTCTCGGGATTTATATCTTGAATCTTTTGATTGGATTTCTGTCACCGAAGGTTGATCCTGA...

Protein

Download Protein FASTA

193 aa · TkA03G315230|TK1151|PROTEIN

MEGSGGDSASPMAPVAKWKTEFSRVFQFYLDKSSPLLVHRWLGTLGVAAIYVLRVYYLEGFYIISYGLGIYILNLLIGFLSPKVDPELEALDGASLPTKESDEFRPFIRRLPEFKFWYAITKAFIVAFFMTFFSVFDVPVFWPILLCYWIVLFTLTMKRQIMHMIKYKYVPFTTGKQKYGGKKSPGGSPSHRG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G315230`
TK1151 ID	TkA03G315230
OH-1004 ID	LXL04_008894
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G315230

Location Chr03:77421291-77422848 (-)

Description Similar to RER1B: Protein RER1B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g21600`	Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.	No verified direct reference in this release
`At4g39220`	Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.	No verified direct reference in this release
`At2g18240`	Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.	No verified direct reference in this release
`At2g23310`	Involved in the retrieval of endoplasmic reticulum membrane proteins from the early Golgi compartment.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008894 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006621 protein retention in ER lumen Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0035437 maintenance of protein localization in endoplasmic reticulum Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005801 cis-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G18240

ath:AT2G21600

ath:AT2G23310

ath:AT4G39220

bta:100125922

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.590

Rank 1 · TkA03G315230 · TK1151

Golgi apparatus0.240

Rank 2 · TkA03G315230 · TK1151

Nucleus0.134

Rank 3 · TkA03G315230 · TK1151

Cytoplasm0.109

Rank 4 · TkA03G315230 · TK1151

Cell membrane0.073

Rank 5 · TkA03G315230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03248Rer118-179 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G315230	`PF03248`	Rer1	18	179	1.8e-75	253.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48671`	Arabidopsis thaliana	sp\|O48671\|RER1B_ARATH Protein RER1B	71.800%	Swiss-Prot	High
`O48670`	Arabidopsis thaliana	sp\|O48670\|RER1A_ARATH Protein RER1A	71.100%	Swiss-Prot	High
`Q9ZPV7`	Arabidopsis thaliana	sp\|Q9ZPV7\|RER1D_ARATH Protein RER1D	70.100%	Swiss-Prot	High
`Q9ZWI7`	Arabidopsis thaliana	sp\|Q9ZWI7\|RER1C_ARATH Protein RER1C	59.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card