TkA03G308430 | RubberDandelionOmics

Gene overview

TkA03G308430

Reference: TK1151 Chr: Chr03 Coordinates: 75801931-75805310 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1528 bp · TkA03G308430|TK1151|cDNA

AAAGATTAATTCCTTCCACCTTATAACTCGCGGCTGATGGCCGGTCTGACGCTTGGTCTCATGTCCCTTGGACTCGTCGACCTCGAAGTCCTCATTCAGTCCGGTCGCCCCAAAGATCGCATACATGCTTCTAAAATATACCCGGTGGTCAAGAATCAACATCTACTGCTTTGCACACTCTTAATTGGCAACGCTTTAGCCATGGAGTCTCTTCCAATTTTTCTGGATAAACTTGTTCCTCCATGGGCTGCAGTTCTGAT...

CDS

Download CDS FASTA

1239 bp · TkA03G308430|TK1151|CDS

ATGGCCGGTCTGACGCTTGGTCTCATGTCCCTTGGACTCGTCGACCTCGAAGTCCTCATTCAGTCCGGTCGCCCCAAAGATCGCATACATGCTTCTAAAATATACCCGGTGGTCAAGAATCAACATCTACTGCTTTGCACACTCTTAATTGGCAACGCTTTAGCCATGGAGTCTCTTCCAATTTTTCTGGATAAACTTGTTCCTCCATGGGCTGCAGTTCTGATATCCGTGACATTAATCCTCATGTTTGGAGAGATACT...

Protein

Download Protein FASTA

412 aa · TkA03G308430|TK1151|PROTEIN

MAGLTLGLMSLGLVDLEVLIQSGRPKDRIHASKIYPVVKNQHLLLCTLLIGNALAMESLPIFLDKLVPPWAAVLISVTLILMFGEILPQAICTRYGLTVGATVAPFVRLLLWLFYPIAYPISKALDWMLGKGHAALLRRAELKTFVDFHGNEAGKGGDLTHDETTIIAGALELTEKTAKDAMTPISKAFSLDLDGTLTLDTLNSIMTMGHSRVPVYYGDRTNIIGIILVKNLLAVDPDDAAPLRKMLLRKVPRVADNMPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G308430`
TK1151 ID	TkA03G308430
OH-1004 ID	LXL04_038536
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	59.400
Protein coverage (%)	TK1151 92.233 / OH-1004 92.381 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G308430

Location Chr03:75801931-75805310 (-)

Description Similar to CBSDUF6: DUF21 domain-containing protein At4g33700

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47330`	DUF21 domain-containing protein At1g47330.	No verified direct reference in this release
`At2g14520`	DUF21 domain-containing protein At2g14520.	No verified direct reference in this release
`At4g33700`	DUF21 domain-containing protein At4g33700.	No verified direct reference in this release
`At5g52790`	DUF21 domain-containing protein At5g52790.	No verified direct reference in this release
`At4g14230`	DUF21 domain-containing protein At4g14230.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038536 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010960 magnesium ion homeostasis Biological Process

GO:1902456 regulation of stomatal opening Biological Process

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G47330

ath:AT2G14520

ath:AT4G14240

ath:AT4G33700

ath:AT5G52790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.610

Rank 1 · TkA03G308430 · TK1151

Endoplasmic reticulum0.173

Rank 2 · TkA03G308430 · TK1151

Cytoplasm0.171

Rank 3 · TkA03G308430 · TK1151

Golgi apparatus0.125

Rank 4 · TkA03G308430 · TK1151

Lysosome / Vacuole0.123

Rank 5 · TkA03G308430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01595CNNM1-160 aa

PF00571CBS196-235 aa

PF00571CBS249-280 aa

PF00571CBS355-369 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G308430	`PF01595`	CNNM	1	160	9.1e-30	104.4
TkA03G308430	`PF00571`	CBS	196	235	2.1e-09	38.2
TkA03G308430	`PF00571`	CBS	249	280	2.1e-09	38.2
TkA03G308430	`PF00571`	CBS	355	369	2.1e-09	38.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY60`	Arabidopsis thaliana	sp\|Q8RY60\|Y1733_ARATH DUF21 domain-containing protein At1g47330	68.700%	Swiss-Prot	High
`Q9ZQR4`	Arabidopsis thaliana	sp\|Q9ZQR4\|Y2452_ARATH DUF21 domain-containing protein At2g14520	59.200%	Swiss-Prot	High
`Q8VZI2`	Arabidopsis thaliana	sp\|Q8VZI2\|Y4370_ARATH DUF21 domain-containing protein At4g33700	58.200%	Swiss-Prot	High
`Q9LTD8`	Arabidopsis thaliana	sp\|Q9LTD8\|Y5279_ARATH DUF21 domain-containing protein At5g52790	53.500%	Swiss-Prot	High
`Q4V3C7`	Arabidopsis thaliana	sp\|Q4V3C7\|Y4423_ARATH DUF21 domain-containing protein At4g14230	50.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card