Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1347 bp · TkA03G307920|TK1151|cDNA
AAAATACACACTTCTCTCTCCTACTCTCCCTCCAATTGTTAGCCGTCCTCCAAAAGATAACCATAGAGATCACATCTCTCCAGTAATCTCCACTTATATGCTTAGCAGTCCTCCAAAATATTACCATAAAGATCACATCTCTCCAACAATCTCCACTTATGCTTAAATATATCAGAGGTTCTTCCAGTTGACTTCAACGATCAAGATTCATTCAATTGTCATCAATATTCATCATCATGGCCATGTTTCGGAGACGTGGG...
873 bp · TkA03G307920|TK1151|CDS
ATGGCCATGTTTCGGAGACGTGGGTCCCAACGACAACAGCTAGAACAAGAGCATAATGAGCAGCATCCTGAGTCCAAGATTAATGAGCTAAAAGCAGCAATTGGCCCACTTTCTGGGCGTAGTCTATTGTATTGTACCGATCCATGCTTGAAAAGATATCTTGAAGCACGAAATTGGAACGTAGAGAAAGCAAAAAAGATGTTGGAAGAGACACTTTCATGGAGATCATCGTACAAGCCAGAAGAAATCCGTTGGAATGA...
Protein
Download Protein FASTA290 aa · TkA03G307920|TK1151|PROTEIN
MAMFRRRGSQRQQLEQEHNEQHPESKINELKAAIGPLSGRSLLYCTDPCLKRYLEARNWNVEKAKKMLEETLSWRSSYKPEEIRWNEIAHEGETGKVFRANFRDRFGRTVLIMKPGRQNTTSMDNQIRHLVYLIENAILNLPEGQEEMAWLIDFTGWSLRTNVSVKTARETISILQNHYPQRLAVAFLYSPPRLFEAFWKVVKYFLDPKTSQKVRFVYLKNKESVELMQSCFDVDNLPIEFGGKANMKYDHEEFSRLMIE...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G307920 |
|---|---|
| TK1151 ID | TkA03G307920 |
| OH-1004 ID | LXL04_008936 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 92.652Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G307920 |
|---|---|
| Location | Chr03:75686420-75689381 (+) |
| Description | Similar to SPCC23B6.04c: CRAL-TRIO domain-containing protein C23B6.04c (Schizosaccharomyces pombe (strain 972 / ATCC 24843) |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006658 phosphatidylserine metabolic process Biological Process GO:0008654 phospholipid biosynthetic process Biological Process GO:0009395 phospholipid catabolic process Biological Process GO:0009410 response to xenobiotic stimulus Biological Process GO:0015914 phospholipid transport Biological Process GO:0016126 sterol biosynthetic process Biological Process GO:0043001 Golgi to plasma membrane protein transport Biological Process GO:0120010 intermembrane phospholipid transfer Biological Process GO:1901352 negative regulation of phosphatidylglycerol biosynthetic process Biological Process GO:2001247 positive regulation of phosphatidylcholine biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005768 endosome Cellular Component |
| KEGG gene cross-reference | ago:AGOS_AER041W ddi:DDB_G0269182 sce:YNL231C sce:YNL264C spo:2539120 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12422Condensin2nSMC42-62 aaPF03765CRAL_TRIO_N45-70 aaPF28528UBA_Pinta46-77 aaPF22566UBA_850-64 aaPF13716CRAL_TRIO_252-73 aaPF00650CRAL_TRIO95-243 aaPF13716CRAL_TRIO_2107-250 aaPF12422Condensin2nSMC128-215 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G307920 | PF12422 | Condensin2nSMC | 42 | 62 | 0.03 | 15.1 |
| TkA03G307920 | PF03765 | CRAL_TRIO_N | 45 | 70 | 2e-08 | 35.0 |
| TkA03G307920 | PF28528 | UBA_Pinta | 46 | 77 | 0.018 | 15.9 |
| TkA03G307920 | PF22566 | UBA_8 | 50 | 64 | 0.081 | 13.5 |
| TkA03G307920 | PF13716 | CRAL_TRIO_2 | 52 | 73 | 4e-07 | 31.1 |
| TkA03G307920 | PF00650 | CRAL_TRIO | 95 | 243 | 4.4e-34 | 118.2 |
| TkA03G307920 | PF13716 | CRAL_TRIO_2 | 107 | 250 | 4e-07 | 31.1 |
| TkA03G307920 | PF12422 | Condensin2nSMC | 128 | 215 | 0.03 | 15.1 |
| TkA03G307920 | PF27038 | DUF8569 | 159 | 191 | 0.087 | 13.5 |
| TkA03G307920 | PF03765 | CRAL_TRIO_N | 195 | 204 | 2e-08 | 35.0 |
| TkA03G307920 | PF27038 | DUF8569 | 210 | 241 | 0.087 | 13.5 |
| TkA03G307920 | PF28528 | UBA_Pinta | 259 | 276 | 0.018 | 15.9 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.