TkA03G307840 | RubberDandelionOmics

Gene overview

TkA03G307840

Reference: TK1151 Chr: Chr03 Coordinates: 75669023-75669619 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · TkA03G307840|TK1151|cDNA

ATGACAGTGGGGAAACTTATGAAAACCTATGGAACCTGCATTTCTGAATTAAGATCTTCTCAATCGAAAACGTGTACTGCTTCTTTGAAAAGAATTTCTCCAGCAAATTTCACAAAAGAGGAAATGTACCTGATACTCTCCAGTCACCTCAAAGAAATTGTTTCCTTAAATAATCTTGACATGGAACTTTACAAGTATGCCAATGAGATATTTCAAAAACAGCATGGAATTATGGAACAGAGATTGCATGATTTTGATTC...

CDS

Download CDS FASTA

405 bp · TkA03G307840|TK1151|CDS

ATGACAGTGGGGAAACTTATGAAAACCTATGGAACCTGCATTTCTGAATTAAGATCTTCTCAATCGAAAACGTGTACTGCTTCTTTGAAAAGAATTTCTCCAGCAAATTTCACAAAAGAGGAAATGTACCTGATACTCTCCAGTCACCTCAAAGAAATTGTTTCCTTAAATAATCTTGACATGGAACTTTACAAGTATGCCAATGAGATATTTCAAAAACAGCATGGAATTATGGAACAGAGATTGCATGATTTTGATTC...

Protein

Download Protein FASTA

134 aa · TkA03G307840|TK1151|PROTEIN

MTVGKLMKTYGTCISELRSSQSKTCTASLKRISPANFTKEEMYLILSSHLKEIVSLNNLDMELYKYANEIFQKQHGIMEQRLHDFDSVTPEKWDVIFSNIDTTWTVVYFLGFMFLTFLICFYKSAKRKISKIKV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G307840`
TK1151 ID	TkA03G307840
OH-1004 ID	LXL04_038579
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	88.800
Protein coverage (%)	TK1151 68.657 / OH-1004 39.676 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G307840

Location Chr03:75669023-75669619 (-)

Description Similar to TPST: Protein-tyrosine sulfotransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g08030`	Catalyzes the O-sulfation of tyrosine residues within acidic motifs of polypeptides.	Identification of tyrosylprotein sulfotransferase in Arabidopsis.2009 · DOI: 10.1073/pnas.0902801106

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038579 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009733 response to auxin Biological Process

GO:0010082 regulation of root meristem growth Biological Process

GO:0010366 negative regulation of ethylene biosynthetic process Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0015012 heparan sulfate proteoglycan biosynthetic process Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0045087 innate immune response Biological Process

GO:0055070 copper ion homeostasis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT1G08030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.474

Rank 1 · TkA03G307840 · TK1151

Nucleus0.190

Rank 2 · TkA03G307840 · TK1151

Cytoplasm0.181

Rank 3 · TkA03G307840 · TK1151

Golgi apparatus0.132

Rank 4 · TkA03G307840 · TK1151

Mitochondrion0.121

Rank 5 · TkA03G307840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3EDG5`	Arabidopsis thaliana	sp\|Q3EDG5\|TPST_ARATH Protein-tyrosine sulfotransferase	48.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card