TkA03G307210 | RubberDandelionOmics

Gene overview

TkA03G307210

Reference: TK1151 Chr: Chr03 Coordinates: 75512850-75517429 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2009 bp · TkA03G307210|TK1151|cDNA

GTATTATTTTGACGCCGTCCATAGAAATAGAATGGCCTGATCCACGGCATATTCTATAGTTTACGATCGCCACCTGTTGTGTCTCTCAAGTTCTTCTTCAATCATCTCCAGATGGCTACTTTAATCTCTGACACTGCACCATGGAAGGACCTTAAGGCCCATGTTACAGACATTGGTAAGACGCATTTACGTGATCTGATGACTGACACTGACCGATGCAAGTCAATGATACTCGAGTTTGATGAAATATTCCTGGATTA...

CDS

Download CDS FASTA

1701 bp · TkA03G307210|TK1151|CDS

ATGGCTACTTTAATCTCTGACACTGCACCATGGAAGGACCTTAAGGCCCATGTTACAGACATTGGTAAGACGCATTTACGTGATCTGATGACTGACACTGACCGATGCAAGTCAATGATACTCGAGTTTGATGAAATATTCCTGGATTATTCACGGCAGTGTGCCACTCTTGATACCATGTCTAAGCTTTTTAAACTTGCTGAGGCAGCTCATCTCAAAGAAAAGATTGCTAGTATGTTCAATGGAGAGCATATAAACAG...

Protein

Download Protein FASTA

566 aa · TkA03G307210|TK1151|PROTEIN

MATLISDTAPWKDLKAHVTDIGKTHLRDLMTDTDRCKSMILEFDEIFLDYSRQCATLDTMSKLFKLAEAAHLKEKIASMFNGEHINSTENRSVLHVALRASKDTTINSDGKNVVPDVWQVLDKIKEFSDKVRNGSWVGATGKSLTNVIAIGIGGSFLGPLFVHTALQTDPEASKTAGGRQLRFLANVDPVDVARNITGLDPETTLVVVVSKTFTTAETMLNARTLREWISSALGPQAVSKHMVAVSTNLKLVEKFGIDPN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G307210`
TK1151 ID	TkA03G307210
OH-1004 ID	LXL04_008940
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G307210`
Location	Chr03:75512850-75517429 (-)
Description	Similar to PGIC: Glucose-6-phosphate isomerase, cytosolic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_008940` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006094 gluconeogenesis Biological Process GO:0006096 glycolytic process Biological Process GO:0051156 glucose 6-phosphate metabolic process Biological Process GO:0005829 cytosol Cellular Component GO:0004347 glucose-6-phosphate isomerase activity Molecular Function GO:0048029 monosaccharide binding Molecular Function GO:0097367 carbohydrate derivative binding Molecular Function
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.717

Rank 1 · TkA03G307210 · TK1151

Nucleus0.166

Rank 2 · TkA03G307210 · TK1151

Mitochondrion0.152

Rank 3 · TkA03G307210 · TK1151

Peroxisome0.090

Rank 4 · TkA03G307210 · TK1151

Cell membrane0.043

Rank 5 · TkA03G307210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00342PGI49-544 aa

PF16942CclA_1134-181 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G307210	`PF00342`	PGI	49	544	3.8e-215	715.8
TkA03G307210	`PF16942`	CclA_1	134	181	0.18	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card