TkA03G305170 | RubberDandelionOmics

Gene overview

TkA03G305170

Reference: TK1151 Chr: Chr03 Coordinates: 75046070-75050523 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1359 bp · TkA03G305170|TK1151|cDNA

CAAAAAGAGTATGACTCGTATAGGGGACCAACTTACTAGATAAACGAGTGCCAGTTTTCCATGGTTGATGAGATATTGAGGGGTGTAGGCTGTCATTGCCTCTCTTTATCTCTCTCTTCTCTCTCACATCATATCATATATGCCCACTGGTATTGTAAATTGGCTCAAACCTCAAAGCTTGCCGTATCAAATAATTTGCTGATATCCTTCACCTGATAAATCTCCACACAAATTTGCTTTACGCGGTTCATCTTTACAGT...

CDS

Download CDS FASTA

735 bp · TkA03G305170|TK1151|CDS

ATGAAATCCACAACAAAGAAGGGATTAACATCTATACCCCCATTCCGATTCAAAGAAAAGTCAACCGCCTGCTTTTGTTTATTTCCAAAAGTCAAACCCGGATACGGCCCACACAATTCCCCAGTTTACCTCAATGTGTATGACCTAACACCCATGAACGGATACGCTTATTGGGCCGGCCTCGGAATCTTTCACTCTGGTGTTGAAGTTCATGGTGTGGAATACGCATTTGGGGCCCACGACTATCCAAGTAGCGGTGT...

Protein

Download Protein FASTA

244 aa · TkA03G305170|TK1151|PROTEIN

MKSTTKKGLTSIPPFRFKEKSTACFCLFPKVKPGYGPHNSPVYLNVYDLTPMNGYAYWAGLGIFHSGVEVHGVEYAFGAHDYPSSGVFEVEPRQCPGFKFRRSILIGTTSLDPVKVREFMEHHAGNYHGDTYHLIVKNCNHFCNDICYNLTGKQIPGWVNRLAKLGSVFSCVLPEALRVSAVEQCVPYENENEKQMLRSRSSFSFLSSRQRQLSVSSLLLQSPLKGCLRPWELRRSTSVVIKNT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G305170`
TK1151 ID	TkA03G305170
OH-1004 ID	LXL04_031605
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	80.700
Protein coverage (%)	TK1151 97.541 / OH-1004 97.200 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G305170

Location Chr03:75046070-75050523 (-)

Description Similar to At4g17486: DeSI-like protein At4g17486

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g17486`	DeSI-like protein At4g17486.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031605 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0016579 protein deubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004843 cysteine-type deubiquitinase activity Molecular Function

GO:0008474 palmitoyl-(protein) hydrolase activity Molecular Function

GO:0052816 long-chain fatty acyl-CoA hydrolase activity Molecular Function

GO:0061578 K63-linked deubiquitinase activity Molecular Function

GO:0101005 deubiquitinase activity Molecular Function

GO:1990380 K48-linked deubiquitinase activity Molecular Function

KEGG gene cross-reference

ath:AT4G17486

cel:CELE_F36D4.5

dre:445138

mmu:78825

xla:496020

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.351

Rank 1 · TkA03G305170 · TK1151

Endoplasmic reticulum0.247

Rank 2 · TkA03G305170 · TK1151

Nucleus0.208

Rank 3 · TkA03G305170 · TK1151

Golgi apparatus0.187

Rank 4 · TkA03G305170 · TK1151

Mitochondrion0.185

Rank 5 · TkA03G305170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05903Peptidase_C9741-175 aa

PF04970LRAT122-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G305170	`PF05903`	Peptidase_C97	41	175	2.9e-50	170.7
TkA03G305170	`PF04970`	LRAT	122	149	0.0051	17.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93VG8`	Arabidopsis thaliana	sp\|Q93VG8\|PPDEX_ARATH DeSI-like protein At4g17486	59.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card