TkA03G299210 | RubberDandelionOmics

Gene overview

TkA03G299210

Reference: TK1151 Chr: Chr03 Coordinates: 73629720-73630246 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

402 bp · TkA03G299210|TK1151|cDNA

ATGATTGTGGCACTTAATTTTTATTTGTGCTCCTCGATTCCACGATGGTGGATCCGCTCCAATCTGCAGCGAAGAAACACAACACAACAAGCAGCAGTTTTGCATATCAGCGATGCCCAGTCCAGTTCATTAGATACATGCGGATTTCACGATATGTACAAAAAGGTGGTTCCCTTTTCCGAAGCATGGTCATGGCAGCGATCGGTTGTTGAAAAACGGAACACATTGATTGATATGAATGAAGATGATTCTGATATATT...

CDS

Download CDS FASTA

402 bp · TkA03G299210|TK1151|CDS

ATGATTGTGGCACTTAATTTTTATTTGTGCTCCTCGATTCCACGATGGTGGATCCGCTCCAATCTGCAGCGAAGAAACACAACACAACAAGCAGCAGTTTTGCATATCAGCGATGCCCAGTCCAGTTCATTAGATACATGCGGATTTCACGATATGTACAAAAAGGTGGTTCCCTTTTCCGAAGCATGGTCATGGCAGCGATCGGTTGTTGAAAAACGGAACACATTGATTGATATGAATGAAGATGATTCTGATATATT...

Protein

Download Protein FASTA

133 aa · TkA03G299210|TK1151|PROTEIN

MIVALNFYLCSSIPRWWIRSNLQRRNTTQQAAVLHISDAQSSSLDTCGFHDMYKKVVPFSEAWSWQRSVVEKRNTLIDMNEDDSDILIMLQHQHVYTLGNASTESNLNFDIKDSPFPLYQIECGGILIMGLDM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G299210`
TK1151 ID	TkA03G299210
OH-1004 ID	LXL04_004652
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	64.100
Protein coverage (%)	TK1151 93.985 / OH-1004 44.599 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G299210

Location Chr03:73629720-73630246 (-)

Description Similar to LIP2P2: Octanoyltransferase LIP2p2, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g31050`	Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes.	Identification of an Arabidopsis cDNA encoding a lipoyltransferase located in plastids.2001 · DOI: 10.1016/s0014-5793(01)02932-5 Two redundant octanoyltransferases and one obligatory lipoyl synthase provide protein-lipoylation autonomy to plastids of Arabidopsis.2014 · DOI: 10.1111/plb.12028

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004652 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009249 protein lipoylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0033819 lipoyl(octanoyl) transferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G47578

ath:AT4G31050

ava:Ava_3883

syc:syc1750_c

syf:Synpcc7942_2353

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.450

Rank 1 · TkA03G299210 · TK1151

Cytoplasm0.382

Rank 2 · TkA03G299210 · TK1151

Mitochondrion0.137

Rank 3 · TkA03G299210 · TK1151

Cell membrane0.102

Rank 4 · TkA03G299210 · TK1151

Endoplasmic reticulum0.080

Rank 5 · TkA03G299210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21948LplA-B_cat61-125 aa

PF21356Vps27_GAT-like67-87 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G299210	`PF21948`	LplA-B_cat	61	125	0.0027	18.4
TkA03G299210	`PF21356`	Vps27_GAT-like	67	87	0.11	13.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q948J9`	Arabidopsis thaliana	sp\|Q948J9\|LIP2P_ARATH Octanoyltransferase LIP2p, chloroplastic	46.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card