TkA03G290330 | RubberDandelionOmics

Gene overview

TkA03G290330

Reference: TK1151 Chr: Chr03 Coordinates: 71581143-71583521 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1759 bp · TkA03G290330|TK1151|cDNA

TTTTTCCTCTGTTTCTCCCGCATCCATAAACAGAACGATGGATTTGCCGACTTTGACACCAGTGGGATCGGCGACAGTTGCATTCGGTGGCCCGGCGGTGGCGGTTGCCAGTGGTATTTCTCTCTTGTTTCTCAAAAGTGTTCTCTCTAATCAAAATGGTCCTCCCAATCACCTTCCATCTGTTCCCGAAGTACCAGGGCTGCCATTAGTTGGGAATTTGCTTGATTTGAAGGAGCAAAAACCCTACAAGACTTTTACAA...

CDS

Download CDS FASTA

1536 bp · TkA03G290330|TK1151|CDS

ATGGATTTGCCGACTTTGACACCAGTGGGATCGGCGACAGTTGCATTCGGTGGCCCGGCGGTGGCGGTTGCCAGTGGTATTTCTCTCTTGTTTCTCAAAAGTGTTCTCTCTAATCAAAATGGTCCTCCCAATCACCTTCCATCTGTTCCCGAAGTACCAGGGCTGCCATTAGTTGGGAATTTGCTTGATTTGAAGGAGCAAAAACCCTACAAGACTTTTACAAGATGGGCAGAAACATATGGCCCTATTTACTCCATCAA...

Protein

Download Protein FASTA

511 aa · TkA03G290330|TK1151|PROTEIN

MDLPTLTPVGSATVAFGGPAVAVASGISLLFLKSVLSNQNGPPNHLPSVPEVPGLPLVGNLLDLKEQKPYKTFTRWAETYGPIYSIKTGATSMVVVNSNEIAKEAMVTRYDSISTRNLSKALKILTSDKTMVAMSDYGNYHKTVKHNLLTSFLGPAARKRHRAHRDAMADNLSTQLHALAPNSHHQPVNLREIFQSQLFSLAFKQTFGKDIGSIYVSDLGITMTRDEMFQILVIDPLMGAIEVDWRDFFPYLKWIPNTKF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G290330`
TK1151 ID	TkA03G290330
OH-1004 ID	LXL04_030414
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	69.900
Protein coverage (%)	TK1151 97.847 / OH-1004 97.471 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G290330

Location Chr03:71581143-71583521 (-)

Description Similar to KO: Ent-kaurene oxidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g25900`	Catalyzes three successive oxidations of the 4-methyl group of ent-kaurene giving kaurenoic acid, a key step in gibberellins (GAs) biosynthesis.	Characterization of the kaurene oxidase CYP701A3, a multifunctional cytochrome P450 from gibberellin biosynthesis.2010 · DOI: 10.1042/bj20100597

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0570100`	Catalyzes three successive oxidations of the 4-methyl group of ent-kaurene giving kaurenoic acid, a key step in gibberellins (GAs) biosynthesis.	CYP701A8: a rice ent-kaurene oxidase paralog diverted to more specialized diterpenoid metabolism.2012 · DOI: 10.1104/pp.111.187518 A conformationally restricted uniconazole analogue as a specific inhibitor of rice ent-kaurene oxidase, CYP701A6.2012 · DOI: 10.1016/j.bmcl.2012.03.028
`Os06g0569900`	May hydroxylate diterpenes.	No verified direct reference in this release
`Os06g0569500`	May catalyze diterpenoid hydroxylation in phytoalexin biosynthesis.	CYP701A8: a rice ent-kaurene oxidase paralog diverted to more specialized diterpenoid metabolism.2012 · DOI: 10.1104/pp.111.187518 Picking sides: distinct roles for CYP76M6 and CYP76M8 in rice oryzalexin biosynthesis.2013 · DOI: 10.1042/bj20130574 Optimization of recombinant expression enables discovery of novel cytochrome P450 activity in rice diterpenoid biosynthesis.2015 · DOI: 10.1007/s00253-015-6496-2

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_030414 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009686 gibberellin biosynthetic process Biological Process

GO:0009740 gibberellic acid mediated signaling pathway Biological Process

GO:0010241 ent-kaurene oxidation to kaurenoic acid Biological Process

GO:0051502 diterpene phytoalexin biosynthetic process Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009707 chloroplast outer membrane Cellular Component

GO:0005506 iron ion binding Molecular Function

GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen Molecular Function

GO:0019825 oxygen binding Molecular Function

GO:0020037 heme binding Molecular Function

GO:0052615 ent-kaurene oxidase activity Molecular Function

KEGG gene cross-reference

ath:AT5G25900

dosa:Os06g0569500

dosa:Os06g0569900

dosa:Os06g0570100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.811

Rank 1 · TkA03G290330 · TK1151

Mitochondrion0.063

Rank 2 · TkA03G290330 · TK1151

Cytoplasm0.047

Rank 3 · TkA03G290330 · TK1151

Peroxisome0.034

Rank 4 · TkA03G290330 · TK1151

Cell membrane0.033

Rank 5 · TkA03G290330 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00067p45051-492 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G290330	`PF00067`	p450	51	492	2.4e-80	271.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZB2`	Arabidopsis thaliana	sp\|Q93ZB2\|KO1_ARATH Ent-kaurene oxidase, chloroplastic	58.600%	Swiss-Prot	High
`Q5Z5R4`	Oryza sativa subsp. japonica	sp\|Q5Z5R4\|C7016_ORYSJ Ent-kaurene oxidase 2	52.700%	Swiss-Prot	High
`Q5Z5R7`	Oryza sativa subsp. japonica	sp\|Q5Z5R7\|C701S_ORYSJ Ent-kaurene oxidase-like 3	53.700%	Swiss-Prot	High
`Q0DBF4`	Oryza sativa subsp. japonica	sp\|Q0DBF4\|C7018_ORYSJ Ent-sandaracopimaradiene 3-hydroxylase	50.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card