TkA03G287020 | RubberDandelionOmics

Gene overview

TkA03G287020

Reference: TK1151 Chr: Chr03 Coordinates: 70843282-70846552 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1008 bp · TkA03G287020|TK1151|cDNA

TTGTTAAAAGGTAAAAGAAAAAAAAATATAACCACGAGAAAAAGAATATTGACTGCCTCTGCGCTCTATCTCCACTTCAACGCCGCAGGGATTTCTTTCGCGCCCTTCAATCGCCGATCGCTACCTGAAAACCTAAAGGAGATGGAATCAATTAGTCCAGTTCCGAAGGGGGGTGTCGTATGTCAGACGTGCGGTGATAAAGGATTCACCAATGCTTTTGTTTACTGTGTTAAGTGCTTGGAATATGTCATTCACAGGTA...

CDS

Download CDS FASTA

1071 bp · TkA03G287020|TK1151|CDS

TTGTTAAAAGGTAAAAGAAAAAAAAATATAACCACGAGAAAAAGAATATTGACTGCCTCTGCGCTCTATCTCCACTTCAACGCCGCAGGGATTTCTTTCGCGCCCTTCAATCGCCGATCGCTACCTGAAAACCTAAAGGAGATGGAATCAATTAGTCCAGTTCCGAAGGGGGGTGTCGTATGTCAGACGTGCGGTGATAAAGGATTCACCAATGCTTTTGTTTACTGTGTTAAGTGCTTGGAATATGTCATTCACAGGTA...

Protein

Download Protein FASTA

356 aa · TkA03G287020|TK1151|PROTEIN

LLKGKRKKNITTRKRILTASALYLHFNAAGISFAPFNRRSLPENLKEMESISPVPKGGVVCQTCGDKGFTNAFVYCVKCLEYVIHRYCLKVMPNTFTEAVIWYCETCKPAVQNQVKSSPSHKNIDPIWSDTSSSDSDSSSISCSNWKEFDEWQARISQQNHRIDRIIDDMVISYPSLILGDNLFTPKKESDIVEETKEVLSQLPKFENIKQDDFYVHAQPIIDPVWRGSLSVGDDIFEGLVGHLSNKACGKVSEEANIMP...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G287020`
TK1151 ID	TkA03G287020
OH-1004 ID	LXL04_018801
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 95.506 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G287020`
Location	Chr03:70843282-70846552 (+)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_018801` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process GO:0045814 negative regulation of gene expression, epigenetic Biological Process GO:2000028 regulation of photoperiodism, flowering Biological Process GO:0005634 nucleus Cellular Component GO:0008270 zinc ion binding Molecular Function GO:0042393 histone binding Molecular Function GO:0061628 histone H3K27me3 reader activity Molecular Function GO:0140566 histone reader activity Molecular Function
KEGG gene cross-reference	ath:AT1G43770 ath:AT5G16680 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.812

Rank 1 · TkA03G287020 · TK1151

Cytoplasm0.223

Rank 2 · TkA03G287020 · TK1151

Cell membrane0.066

Rank 3 · TkA03G287020 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA03G287020 · TK1151

Plastid0.019

Rank 5 · TkA03G287020 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03107C1_257-88 aa

PF13831PHD_259-64 aa

PF00628PHD61-107 aa

PF25054PHD_pln64-106 aa

PF13831PHD_270-108 aa

PF03107C1_2102-109 aa

PF23121SPOC_AIPP2226-348 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G287020	`PF03107`	C1_2	57	88	0.03	15.4
TkA03G287020	`PF13831`	PHD_2	59	64	0.24	11.6
TkA03G287020	`PF00628`	PHD	61	107	0.0034	18.1
TkA03G287020	`PF25054`	PHD_pln	64	106	5.6e-05	23.7
TkA03G287020	`PF13831`	PHD_2	70	108	0.24	11.6
TkA03G287020	`PF03107`	C1_2	102	109	0.03	15.4
TkA03G287020	`PF23121`	SPOC_AIPP2	226	348	9.5e-36	123.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card