TkA03G284940 | RubberDandelionOmics

Gene overview

TkA03G284940

Reference: TK1151 Chr: Chr03 Coordinates: 70328678-70332906 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1714 bp · TkA03G284940|TK1151|cDNA

CTCACAAAAGACTTCATGCTTTTCCAACACCCCACCAAACACATCTCACATTACATTCTTCAAAGCTAACAATGGAGTGTTGCTTCAAAACGAGAAGCCATTTACATCTTCAAATGAGAGAGATGATATGGTTGTTAGTGGTGGTGATGGTGGTGGCAAGTATGGGCGGAGGAGTTGAGAGCAGAAAAACAAGAAAACTAGGGGGGTCATTTGAGTACACAGCAATAAACTGCAGGGGCCACAGTGCATCAATTATAGAA...

CDS

Download CDS FASTA

1452 bp · TkA03G284940|TK1151|CDS

ATGGAGTGTTGCTTCAAAACGAGAAGCCATTTACATCTTCAAATGAGAGAGATGATATGGTTGTTAGTGGTGGTGATGGTGGTGGCAAGTATGGGCGGAGGAGTTGAGAGCAGAAAAACAAGAAAACTAGGGGGGTCATTTGAGTACACAGCAATAAACTGCAGGGGCCACAGTGCATCAATTATAGAATTTGGAGGGGTTGGAGATGGCAAAACGCTAAATACAAAGGCCTTTCAGGAAGCAGTGAATTCATTGAGCCA...

Protein

Download Protein FASTA

483 aa · TkA03G284940|TK1151|PROTEIN

MECCFKTRSHLHLQMREMIWLLVVVMVVASMGGGVESRKTRKLGGSFEYTAINCRGHSASIIEFGGVGDGKTLNTKAFQEAVNSLSQYSSDGGAQLYVPAGQWLTGSFNLTSHFTLFLHKDATLLASQDINAWPVIDPLPSYGHGRDAAGGRYISLIFGTNLTDVIITGDNGTIDGQGLLWWQKFHGKKLKYTRPYLFEIMYSDTIQISNITFLNSPSWNVHPVYSSNILLQGITILAPVQSPNTDGINPDSCSNTRIED...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G284940`
TK1151 ID	TkA03G284940
OH-1004 ID	LXL04_026704
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G284940`
Location	Chr03:70328678-70332906 (+)
Description	Similar to GSVIVT00026920001: Probable polygalacturonase
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026704` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0009835 fruit ripening Biological Process GO:0045490 pectin catabolic process Biological Process GO:0071555 cell wall organization Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009501 amyloplast Cellular Component GO:0009505 plant-type cell wall Cellular Component GO:0016020 membrane Cellular Component GO:0004650 polygalacturonase activity Molecular Function
KEGG gene cross-reference	ath:AT3G15720 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.383

Rank 1 · TkA03G284940 · TK1151

Lysosome / Vacuole0.257

Rank 2 · TkA03G284940 · TK1151

Cytoplasm0.142

Rank 3 · TkA03G284940 · TK1151

Cell membrane0.119

Rank 4 · TkA03G284940 · TK1151

Endoplasmic reticulum0.112

Rank 5 · TkA03G284940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12708Pect-lyase_RHGA_epim61-105 aa

PF00295Glyco_hydro_28155-436 aa

PF13229Beta_helix196-271 aa

PF12708Pect-lyase_RHGA_epim218-309 aa

PF12708Pect-lyase_RHGA_epim256-358 aa

PF13229Beta_helix406-417 aa

PF00295Glyco_hydro_28414-477 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G284940	`PF12708`	Pect-lyase_RHGA_epim	61	105	3e-07	31.2
TkA03G284940	`PF00295`	Glyco_hydro_28	155	436	1.4e-33	117.1
TkA03G284940	`PF13229`	Beta_helix	196	271	0.027	14.8
TkA03G284940	`PF12708`	Pect-lyase_RHGA_epim	218	309	3e-07	31.2
TkA03G284940	`PF12708`	Pect-lyase_RHGA_epim	256	358	3e-07	31.2
TkA03G284940	`PF13229`	Beta_helix	406	417	0.027	14.8
TkA03G284940	`PF00295`	Glyco_hydro_28	414	477	1.4e-33	117.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card