TkA03G282760 | RubberDandelionOmics

Gene overview

TkA03G282760

Reference: TK1151 Chr: Chr03 Coordinates: 69767643-69768410 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

768 bp · TkA03G282760|TK1151|cDNA

ATGACACCACCACCGGAACCAGTGACCGCTATTGATCTATCTCCGGCGGATGATATCTTCTTCCATGGCCACCTCCTTCCCCTCCACCTCCTATCTCATCTTCCCATATCACCTCGTTCCTCAACAAATTCAATGGACAGTTTTACCCTCCCATCGAAGGATATACTAAAAGACCAACATAACCCCATCGGCAACACTAGTTTCCATTATCACCACCGGAACACCTTCTCCGATTTCAACTTACCCAGCAACAATGTTAA...

CDS

Download CDS FASTA

768 bp · TkA03G282760|TK1151|CDS

ATGACACCACCACCGGAACCAGTGACCGCTATTGATCTATCTCCGGCGGATGATATCTTCTTCCATGGCCACCTCCTTCCCCTCCACCTCCTATCTCATCTTCCCATATCACCTCGTTCCTCAACAAATTCAATGGACAGTTTTACCCTCCCATCGAAGGATATACTAAAAGACCAACATAACCCCATCGGCAACACTAGTTTCCATTATCACCACCGGAACACCTTCTCCGATTTCAACTTACCCAGCAACAATGTTAA...

Protein

Download Protein FASTA

255 aa · TkA03G282760|TK1151|PROTEIN

MTPPPEPVTAIDLSPADDIFFHGHLLPLHLLSHLPISPRSSTNSMDSFTLPSKDILKDQHNPIGNTSFHYHHRNTFSDFNLPSNNVNPSRPKAKSFSLFGRHKGRKEVGDERERVHEERNNNNNSKKKMKLEVAQLIKRYIKMVRPLLSFPKARRPNGTECNIQPPNSFSGNLVSSRSSLPLQMNRGGGKNRGEFSAPASMRTSPANSGILLASGTVSPAKSTSSDSTMEELQAAIQAAIAHCKNSIAMEDKIQA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G282760`
TK1151 ID	TkA03G282760
OH-1004 ID	LXL04_008164
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	96.900
Protein coverage (%)	TK1151 100.000 / OH-1004 74.561 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G282760

Location Chr03:69767643-69768410 (-)

Description Similar to BKI1: BRI1 kinase inhibitor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42750`	Negative regulator of brassinosteroid signaling.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0459500`	Negative regulator of brassinosteroid signaling.	No verified direct reference in this release
`UniProt: A2Z225`	Negative regulator of brassinosteroid signaling.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008164 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010423 negative regulation of brassinosteroid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0004860 protein kinase inhibitor activity Molecular Function

GO:0019210 kinase inhibitor activity Molecular Function

GO:0046982 protein heterodimerization activity Molecular Function

KEGG gene cross-reference

ath:AT5G26230

ath:AT5G42750

dosa:Os09g0459500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.591

Rank 1 · TkA03G282760 · TK1151

Nucleus0.358

Rank 2 · TkA03G282760 · TK1151

Cytoplasm0.273

Rank 3 · TkA03G282760 · TK1151

Endoplasmic reticulum0.050

Rank 4 · TkA03G282760 · TK1151

Plastid0.024

Rank 5 · TkA03G282760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF30743BKI17-254 aa

PF30942MAKR613-48 aa

PF30362MAKR5_C17-247 aa

PF30942MAKR6115-248 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G282760	`PF30743`	BKI1	7	254	6.3e-86	289.0
TkA03G282760	`PF30942`	MAKR6	13	48	0.018	15.9
TkA03G282760	`PF30362`	MAKR5_C	17	247	1.9e-08	35.0
TkA03G282760	`PF30942`	MAKR6	115	248	0.018	15.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMZ0`	Arabidopsis thaliana	sp\|Q9FMZ0\|BKI1_ARATH BRI1 kinase inhibitor 1	45.800%	Swiss-Prot	Medium
`Q67J19`	Oryza sativa subsp. japonica	sp\|Q67J19\|BKI1_ORYSJ Probable BRI1 kinase inhibitor 1	46.400%	Swiss-Prot	Low
`A2Z225`	Oryza sativa subsp. indica	sp\|A2Z225\|BKI1_ORYSI Probable BRI1 kinase inhibitor 1	46.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card