TkA03G261840 | RubberDandelionOmics

Gene overview

TkA03G261840

Reference: TK1151 Chr: Chr03 Coordinates: 64949745-64951980 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1525 bp · TkA03G261840|TK1151|cDNA

CAAAATTGAATTTTTTGAAATCCAGCAAAAATGGCGGTATCTTTCTTTTTTATAACAATCGCGATTATAAGTTATAACACACTTTCACAATCTCCATCTCCGCCGATCTGTATTTTGCCTTTTGTCTGGTGTAGAATCTAATCAATGGCTGACCAGGAGAATAAGAGAGTTACGCGAATGGCGAAGAAGAGGGCTATTGAGGCAATCGCATCTCAGTTGCAACCAGCGAAGAAGAATAGAGTCGTTTTGGGCGAGCTCTC...

CDS

Download CDS FASTA

1107 bp · TkA03G261840|TK1151|CDS

ATGGCTGACCAGGAGAATAAGAGAGTTACGCGAATGGCGAAGAAGAGGGCTATTGAGGCAATCGCATCTCAGTTGCAACCAGCGAAGAAGAATAGAGTCGTTTTGGGCGAGCTCTCGAACAATGCGGTGGTGTCTGATAGCGAGGCAACGATATCTGACTTGGTTAAGATTCAAAAGCCGAAATGTAGATCAAAGAAGGGCAAGAAGGCCGTGAAGGCGGTTCTGGAAACTCAGGAACTGTCTGCGGACAAAATCGACGA...

Protein

Download Protein FASTA

368 aa · TkA03G261840|TK1151|PROTEIN

MADQENKRVTRMAKKRAIEAIASQLQPAKKNRVVLGELSNNAVVSDSEATISDLVKIQKPKCRSKKGKKAVKAVLETQELSADKIDEKSSDPQMCEAYVADVYEYLHNMEIEARRRPMPDYIEKVQKDVTVNMRAILVDWLVEVAEEYKLLSDTLYLTISHIDKFLSTNPLNRQRLQLLGVSSMLIAAKYEEISPPHTEEFCYITDNTYTKQEVVKMEEDVLKALKFEMGNPTVKSFLRRLTVVAQEDLQKPILHMEFLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G261840`
TK1151 ID	TkA03G261840
OH-1004 ID	LXL04_008040
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G261840

Location Chr03:64949745-64951980 (+)

Description Similar to CYCA3-4: Cyclin-A3-4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47230`	Cyclin-A3-4.	No verified direct reference in this release
`At5g43080`	Putative cyclin-A3-1.	No verified direct reference in this release
`At1g47210`	Cyclin-A3-2.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0607600`	Cyclin-A3-1.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008040 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000082 G1/S transition of mitotic cell cycle Biological Process

GO:0051301 cell division Biological Process

GO:0000307 cyclin-dependent protein kinase holoenzyme complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0016538 cyclin-dependent protein serine/threonine kinase regulator activity Molecular Function

KEGG gene cross-reference

ath:AT1G47210

ath:AT1G47230

ath:AT5G43080

dosa:Os12g0581800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.837

Rank 1 · TkA03G261840 · TK1151

Cytoplasm0.238

Rank 2 · TkA03G261840 · TK1151

Mitochondrion0.041

Rank 3 · TkA03G261840 · TK1151

Cell membrane0.023

Rank 4 · TkA03G261840 · TK1151

Endoplasmic reticulum0.012

Rank 5 · TkA03G261840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05008V-SNARE13-29 aa

PF05008V-SNARE77-117 aa

PF27168Rv2576c_beta84-112 aa

PF00134Cyclin_N101-229 aa

PF02984Cyclin_C185-223 aa

PF27168Rv2576c_beta188-242 aa

PF02984Cyclin_C232-354 aa

PF00134Cyclin_N274-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G261840	`PF05008`	V-SNARE	13	29	0.22	12.7
TkA03G261840	`PF05008`	V-SNARE	77	117	0.22	12.7
TkA03G261840	`PF27168`	Rv2576c_beta	84	112	0.12	13.5
TkA03G261840	`PF00134`	Cyclin_N	101	229	1.8e-45	154.5
TkA03G261840	`PF02984`	Cyclin_C	185	223	1.2e-35	122.8
TkA03G261840	`PF27168`	Rv2576c_beta	188	242	0.12	13.5
TkA03G261840	`PF02984`	Cyclin_C	232	354	1.2e-35	122.8
TkA03G261840	`PF00134`	Cyclin_N	274	294	1.8e-45	154.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3ECW2`	Arabidopsis thaliana	sp\|Q3ECW2\|CCA34_ARATH Cyclin-A3-4	54.900%	Swiss-Prot	High
`Q9FMH5`	Arabidopsis thaliana	sp\|Q9FMH5\|CCA31_ARATH Putative cyclin-A3-1	55.900%	Swiss-Prot	High
`Q9C6A9`	Arabidopsis thaliana	sp\|Q9C6A9\|CCA32_ARATH Cyclin-A3-2	54.800%	Swiss-Prot	High
`Q75I54`	Oryza sativa subsp. japonica	sp\|Q75I54\|CCA31_ORYSJ Cyclin-A3-1	52.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card