TkA03G258760 | RubberDandelionOmics

Gene overview

TkA03G258760

Reference: TK1151 Chr: Chr03 Coordinates: 64181172-64184996 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2900 bp · TkA03G258760|TK1151|cDNA

CGTCTGGTTGTTAAAGTCGATCGTCATGGAAAAATATAAAGTAGAATCAAAATTATGGCAGCACACTCATTACGAAAACCTTGTGACCCGCAACACCTTTTGGCCCCACAACAAAATGGGCAAAAGTGGCTGCTTCCATAACCCCCCACCATAAAGAATAAAGCGAATATGCTTTGCTCTCATCTCTGACAACCAAAATCTTTCATCTTCATCCCAGTTTTATCCCTCGTTTAAAATCCCACAAATTACTCCTACTATTA...

CDS

Download CDS FASTA

1257 bp · TkA03G258760|TK1151|CDS

ATGGAGACGCTACAGCAGATTTTGTTGACGGTTATTGCAGGTTTTGTGTTCTTTATCCTGATTGCAAAGATCGCTTCTGCCGTGACCAATGGCGATGAAGATGATCATCAAAGTAGGAGAACCCTTGATTTCAGTAAGGTTTTGGCGGAGGAACTTAATTCGAAGATGGAGAAAAGTAGTCGTAAAATGAAAAGCATGAAGAAAGTCCGATTTGCTGTCGATCACGATGAAACTTTAGTAAATAAGGTCGTCGTCGGGCC...

Protein

Download Protein FASTA

418 aa · TkA03G258760|TK1151|PROTEIN

METLQQILLTVIAGFVFFILIAKIASAVTNGDEDDHQSRRTLDFSKVLAEELNSKMEKSSRKMKSMKKVRFAVDHDETLVNKVVVGPSETKQVVFVENNHEKEIISLNDVGSVVKSAEEEFVGVENSASGDNKSRAESVSTSVVDYGKTKQGNTETVDQKSSEGTVNPYENAAIGINDQMSSKLLSDDGSVKNDDEEMISLNDVISVVKSPEEESVGVEHSDSDDNKSNVESVTPGVVDYDQTKEGNTELLEQKSNQCPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G258760`
TK1151 ID	TkA03G258760
OH-1004 ID	LXL04_008013
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.100
Protein coverage (%)	TK1151 97.368 / OH-1004 92.922 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G258760

Location Chr03:64181172-64184996 (+)

Description Similar to ACBP3: Acyl-CoA-binding domain-containing protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g24230`	Binds medium- and long-chain acyl-CoA esters with very high affinity.	Arabidopsis ACBP3 is an extracellularly targeted acyl-CoA-binding protein.2006 · DOI: 10.1007/s00425-005-0139-2
`At5g53470`	Binds medium- and long-chain acyl-CoA esters with very high affinity.	Arabidopsis ACBP3 is an extracellularly targeted acyl-CoA-binding protein.2006 · DOI: 10.1007/s00425-005-0139-2 Overexpression of membrane-associated acyl-CoA-binding protein ACBP1 enhances lead tolerance in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03402.x Acyl-CoA-Binding Protein ACBP1 Modulates Sterol Synthesis during Embryogenesis.2017 · DOI: 10.1104/pp.17.00412 Arabidopsis ACYL-COA-BINDING PROTEIN1 interacts with STEROL C4-METHYL OXIDASE1-2 to modulate gene expression of homeodomain-leucine zipper IV transcription factors.2018 · DOI: 10.1111/nph.14965
`At4g27780`	Binds medium- and long-chain acyl-CoA esters with very high affinity.	Single amino acid substitutions at the acyl-CoA-binding domain interrupt 14[C]palmitoyl-CoA binding of ACBP2, an Arabidopsis acyl-CoA-binding protein with ankyrin repeats.2000 · DOI: 10.1023/a:1026524108095 ACBP4 and ACBP5, novel Arabidopsis acyl-CoA-binding proteins with kelch motifs that bind oleoyl-CoA.2004 · DOI: 10.1007/s11103-004-0642-z Overexpression of membrane-associated acyl-CoA-binding protein ACBP1 enhances lead tolerance in Arabidopsis.2008 · DOI: 10.1111/j.1365-313x.2008.03402.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0681900`	Binds medium- and long-chain acyl-CoA esters with high affinity.	The rice acyl-CoA-binding protein gene family: phylogeny, expression and functional analysis.2011 · DOI: 10.1111/j.1469-8137.2010.03546.x Subcellular localization of rice acyl-CoA-binding proteins (ACBPs) indicates that OsACBP6::GFP is targeted to the peroxisomes.2014 · DOI: 10.1111/nph.12809
`Os03g0243600`	Binds medium- and long-chain acyl-CoA esters with high affinity.	The rice acyl-CoA-binding protein gene family: phylogeny, expression and functional analysis.2011 · DOI: 10.1111/j.1469-8137.2010.03546.x Subcellular localization of rice acyl-CoA-binding proteins (ACBPs) indicates that OsACBP6::GFP is targeted to the peroxisomes.2014 · DOI: 10.1111/nph.12809

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_008013 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001666 response to hypoxia Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0006631 fatty acid metabolic process Biological Process

GO:0006869 lipid transport Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009617 response to bacterium Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010162 seed dormancy process Biological Process

GO:0010288 response to lead ion Biological Process

KEGG gene cross-reference

ath:AT4G24230

ath:AT4G27780

ath:AT5G53470

dosa:Os03g0243600

dosa:Os04g0681900

osa:4332223

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · TkA03G258760 · TK1151

Nucleus0.283

Rank 2 · TkA03G258760 · TK1151

Cell membrane0.248

Rank 3 · TkA03G258760 · TK1151

Endoplasmic reticulum0.121

Rank 4 · TkA03G258760 · TK1151

Golgi apparatus0.103

Rank 5 · TkA03G258760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29160YBR138C_C24-67 aa

PF00887ACBP146-165 aa

PF29160YBR138C_C263-323 aa

PF00887ACBP312-386 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G258760	`PF29160`	YBR138C_C	24	67	0.12	13.6
TkA03G258760	`PF00887`	ACBP	146	165	5.5e-23	81.6
TkA03G258760	`PF29160`	YBR138C_C	263	323	0.12	13.6
TkA03G258760	`PF00887`	ACBP	312	386	5.5e-23	81.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STX1`	Arabidopsis thaliana	sp\|Q9STX1\|ACBP3_ARATH Acyl-CoA-binding domain-containing protein 3	49.600%	Swiss-Prot	Low
`Q9SM23`	Arabidopsis thaliana	sp\|Q9SM23\|ACBP1_ARATH Acyl-CoA-binding domain-containing protein 1	50.900%	Swiss-Prot	Low
`Q9STP8`	Arabidopsis thaliana	sp\|Q9STP8\|ACBP2_ARATH Acyl-CoA-binding domain-containing protein 2	46.000%	Swiss-Prot	Low
`A3AYR1`	Oryza sativa subsp. japonica	sp\|A3AYR1\|ACBP4_ORYSJ Acyl-CoA-binding domain-containing protein 4	49.000%	Swiss-Prot	Low
`Q10P83`	Oryza sativa subsp. japonica	sp\|Q10P83\|ACBP5_ORYSJ Acyl-CoA-binding domain-containing protein 5	52.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card