TkA03G253930 | RubberDandelionOmics

Gene overview

TkA03G253930

Reference: TK1151 Chr: Chr03 Coordinates: 62962997-62965043 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1500 bp · TkA03G253930|TK1151|cDNA

TTCAAACACGCTTAGTATCATAAGTTTTGCCGCCTTCAGAATGTGAATTTGAAATTAAAGTCGATAGGTAAATTCTAGGGTTTTGATTCTGTTTTGCTGTTTAATTTTGGTTTTCTACAGATGATTGCACCAAACGCTCATGAGGTAGCTTTAGGAGAAGTAATGGTGGATTTACTGAATGCTGTAGTATTACAAGCTAAAAAAAACCGCCAATTTTAGGACTCTACTCAAGCGGATCGAGAAAACTCTAAGGAACATCG...

CDS

Download CDS FASTA

1026 bp · TkA03G253930|TK1151|CDS

ATGAGTCTTAACAGAAGGAGTTTGTTTGAGATTTATGCTTTAAGAGACAAAATGGATCAAGTCCTTACATCCGTTACCAAACAGACATCTGGATTAGTTTCAGATTCCTGCAGTGTTCCAGGGATGCCAGATGTCATCATCGGATTGGATTCTCATGTCCAAAATCTGAAACAAATTCTGCTCAAAGATGACACCCACGTCTTAACCGTTTCAGCTCCTGGAAGATGCGGAAAGACCACATTAGCAAAGATGCTCTGTCA...

Protein

Download Protein FASTA

341 aa · TkA03G253930|TK1151|PROTEIN

MSLNRRSLFEIYALRDKMDQVLTSVTKQTSGLVSDSCSVPGMPDVIIGLDSHVQNLKQILLKDDTHVLTVSAPGRCGKTTLAKMLCHDNEIKDIFGDNILYLTVSRTTSLKTIIQKLFSHFNVNACELETNEDAKNQLENMFRKMGSKNILLMVKYCKGFPLALTVIGASLCGQNMVKWRTTLKKLSEGQSSSVDALEDLGIVKECFLDLGSFPEDERIPASALMDIWVELYDLDEEGMYTTEYLLELSSRNLLNLVLTR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G253930`
TK1151 ID	TkA03G253930
OH-1004 ID	LXL04_006343
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	72.700
Protein coverage (%)	TK1151 96.774 / OH-1004 51.040 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G253930

Location Chr03:62962997-62965043 (+)

Description Similar to At5g66900: Probable disease resistance protein At5g66900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g33560`	Disease resistance (R) protein that mediates resistance against Hyaloperonospora parasitica in a salicylic acid-dependent manner.	Targeted activation tagging of the Arabidopsis NBS-LRR gene, ADR1, conveys resistance to virulent pathogens.2003 · DOI: 10.1094/mpmi.2003.16.8.669
`At4g33300`	Probable disease resistance protein.	No verified direct reference in this release
`At5g66900`	Probable disease resistance protein.	No verified direct reference in this release
`At5g66910`	Probable disease resistance protein.	No verified direct reference in this release
`At5g47280`	Potential disease resistance protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006343 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0048046 apoplast Cellular Component

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

KEGG gene cross-reference

ath:AT4G33300

ath:AT5G04720

ath:AT5G47280

ath:AT5G66900

ath:AT5G66910

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.438

Rank 1 · TkA03G253930 · TK1151

Nucleus0.220

Rank 2 · TkA03G253930 · TK1151

Endoplasmic reticulum0.190

Rank 3 · TkA03G253930 · TK1151

Cell membrane0.128

Rank 4 · TkA03G253930 · TK1151

Extracellular0.113

Rank 5 · TkA03G253930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00931NB-ARC50-153 aa

PF01637ATPase_253-142 aa

PF20720nSTAND358-88 aa

PF24883NPHP3_N60-128 aa

PF00821PEPCK_GTP63-113 aa

PF13401AAA_2267-147 aa

PF13173AAA_1467-103 aa

PF00004AAA73-149 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G253930	`PF00931`	NB-ARC	50	153	2.3e-10	41.0
TkA03G253930	`PF01637`	ATPase_2	53	142	0.052	14.1
TkA03G253930	`PF20720`	nSTAND3	58	88	0.022	15.1
TkA03G253930	`PF24883`	NPHP3_N	60	128	0.026	15.5
TkA03G253930	`PF00821`	PEPCK_GTP	63	113	0.14	11.6
TkA03G253930	`PF13401`	AAA_22	67	147	4.1e-05	24.6
TkA03G253930	`PF13173`	AAA_14	67	103	0.0058	17.3
TkA03G253930	`PF00004`	AAA	73	149	0.26	12.5
TkA03G253930	`PF13173`	AAA_14	107	145	0.0058	17.3
TkA03G253930	`PF23580`	Znf_XAF1_N	289	300	0.13	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FW44`	Arabidopsis thaliana	sp\|Q9FW44\|ADR1_ARATH Disease resistance protein ADR1	26.200%	Swiss-Prot	Low
`Q9SZA7`	Arabidopsis thaliana	sp\|Q9SZA7\|DRL29_ARATH Probable disease resistance protein At4g33300	37.000%	Swiss-Prot	Medium
`Q9FKZ1`	Arabidopsis thaliana	sp\|Q9FKZ1\|DRL42_ARATH Probable disease resistance protein At5g66900	36.800%	Swiss-Prot	Medium
`Q9FKZ0`	Arabidopsis thaliana	sp\|Q9FKZ0\|DRL43_ARATH Probable disease resistance protein At5g66910	37.000%	Swiss-Prot	Medium
`Q9LVT1`	Arabidopsis thaliana	sp\|Q9LVT1\|DRL39_ARATH Putative disease resistance protein At5g47280	32.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card