TkA03G232210 | RubberDandelionOmics

Gene overview

TkA03G232210

Reference: TK1151 Chr: Chr03 Coordinates: 57914161-57915954 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

942 bp · TkA03G232210|TK1151|cDNA

ATGTGGTGTAAAGGTCGTGAAGATAAAGAAGGTGAAATTAAGGAAGACAATGTTAAGCTCATTGCGGATAAAGTAATGGAAAGTGAACAGCAGATAAAAAATGGAAAAGTAGTACTTGAGCCGGGGACGGATGCCATGAGCTTAGTTTTTGGCCAAGAGAAGGGCAGATTTTTAAAGGGTGTGGGAACCGGAGTGACTGCCACCAGATTTTTCCATATCCGTCACAACAAAGGAACAACTAACTCATCTTGCTGCTACAG...

CDS

Download CDS FASTA

942 bp · TkA03G232210|TK1151|CDS

ATGTGGTGTAAAGGTCGTGAAGATAAAGAAGGTGAAATTAAGGAAGACAATGTTAAGCTCATTGCGGATAAAGTAATGGAAAGTGAACAGCAGATAAAAAATGGAAAAGTAGTACTTGAGCCGGGGACGGATGCCATGAGCTTAGTTTTTGGCCAAGAGAAGGGCAGATTTTTAAAGGGTGTGGGAACCGGAGTGACTGCCACCAGATTTTTCCATATCCGTCACAACAAAGGAACAACTAACTCATCTTGCTGCTACAG...

Protein

Download Protein FASTA

313 aa · TkA03G232210|TK1151|PROTEIN

MWCKGREDKEGEIKEDNVKLIADKVMESEQQIKNGKVVLEPGTDAMSLVFGQEKGRFLKGVGTGVTATRFFHIRHNKGTTNSSCCYRGTSIENVAESHGTADISISKEPTDEPLTPNNSVAAIHDTPSPSITPALSKTTKNVFAPKTATTILDVPAISTKNPLNQDSYLPHETDGMKTVEDAFKSFVAWPKYIVKTDAKVVKTSEGNEAAVKQVVKSAVKQVVKSTVKLVNVPVVQPSEGNEAVVKPVLKTAVKLVNVPV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G232210`
TK1151 ID	TkA03G232210
OH-1004 ID	LXL04_034503
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	57.600
Protein coverage (%)	TK1151 100.000 / OH-1004 61.613 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G232210`
Location	Chr03:57914161-57915954 (+)
Description	Similar to COP1: E3 ubiquitin-protein ligase COP1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_034503` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006281 DNA repair Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009585 red, far-red light phototransduction Biological Process GO:0009637 response to blue light Biological Process GO:0009640 photomorphogenesis Biological Process GO:0009641 shade avoidance Biological Process GO:0009647 skotomorphogenesis Biological Process GO:0009649 entrainment of circadian clock Biological Process GO:0009963 positive regulation of flavonoid biosynthetic process Biological Process GO:0010119 regulation of stomatal movement Biological Process GO:0010212 response to ionizing radiation Biological Process GO:0010224 response to UV-B Biological Process
KEGG gene cross-reference	ath:AT1G53090 ath:AT2G32950 hsa:64326 mmu:26374 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.868

Rank 1 · TkA03G232210 · TK1151

Cytoplasm0.182

Rank 2 · TkA03G232210 · TK1151

Mitochondrion0.028

Rank 3 · TkA03G232210 · TK1151

Cell membrane0.023

Rank 4 · TkA03G232210 · TK1151

Endoplasmic reticulum0.011

Rank 5 · TkA03G232210 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11247Phage_T7_5513-37 aa

PF18352Gp138_N131-156 aa

PF26133DUF8039165-195 aa

PF01390SEA193-227 aa

PF11247Phage_T7_55204-228 aa

PF18352Gp138_N209-249 aa

PF26133DUF8039215-234 aa

PF10751DUF2535220-244 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G232210	`PF11247`	Phage_T7_55	13	37	0.043	14.9
TkA03G232210	`PF18352`	Gp138_N	131	156	1.4	9.6
TkA03G232210	`PF26133`	DUF8039	165	195	0.00058	21.0
TkA03G232210	`PF01390`	SEA	193	227	1.0	10.3
TkA03G232210	`PF11247`	Phage_T7_55	204	228	0.043	14.9
TkA03G232210	`PF18352`	Gp138_N	209	249	1.4	9.6
TkA03G232210	`PF26133`	DUF8039	215	234	0.00058	21.0
TkA03G232210	`PF10751`	DUF2535	220	244	0.092	14.1
TkA03G232210	`PF10751`	DUF2535	252	302	0.092	14.1
TkA03G232210	`PF18352`	Gp138_N	253	275	1.4	9.6
TkA03G232210	`PF01390`	SEA	255	308	1.0	10.3
TkA03G232210	`PF11247`	Phage_T7_55	264	284	0.043	14.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card