TkA03G227250 | RubberDandelionOmics

Gene overview

TkA03G227250

Reference: TK1151 Chr: Chr03 Coordinates: 56794339-56797845 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2366 bp · TkA03G227250|TK1151|cDNA

GTGCGACTCCATATCTGCGGCGATAACTGGGTGCGACTCCATAGCAATCGATGATTTTGAATGAAACCGACGGATGCAATTCCTTTTATATACCGATCACAATGAGCAGCAGTTGATGCATCGTGGGGCGGTTCCATATGCGAAGCAGGAAGAAGGAGGAAGAAGGAGCAGAGTGAGAGTGAGATCGTGAAATCGTGAACCTAGCAAAGCAAAAAGTGTTTGTACCAAGTGCAGTAGTATAGATACGCGTCTTAAAATAC...

CDS

Download CDS FASTA

1575 bp · TkA03G227250|TK1151|CDS

ATGGCAACTGCGATTCCTCAACAAAATTCTTCCAGTACGACATCTCATACAGACATTCCGAATCTGCACACTCCAAAGAAGCATTCACCATTTAATCTGACCTCAATCGTGCGGGTAATTGTTAGGGTTCGTCCATTTTTGCCTCACGAGATTTCTAGGTCAAGTGATAAAGCAATTCCATGTGTGTCCGTTCTTGATTTACCACTACAGTCTGACTCAGAAGTTACTGTGAGCGTCAAAGATCCCCACTCCTGTCGGAA...

Protein

Download Protein FASTA

524 aa · TkA03G227250|TK1151|PROTEIN

MATAIPQQNSSSTTSHTDIPNLHTPKKHSPFNLTSIVRVIVRVRPFLPHEISRSSDKAIPCVSVLDLPLQSDSEVTVSVKDPHSCRNESYKLDSFYGEKDNNLRRIFEREVMPLVPAVLNGYNATVFAYGATGSGKTFTMQGSEELPGLMAMAAAAILSMTEKRVEISYYEIYMERCYDLLEEKEITILEDKDGRPHLKNLVKIPIHSMADFHETMRRGTQRRKIAHTGLNDVSSRSHGVLVISVSENSSLIGKLNLIDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G227250`
TK1151 ID	TkA03G227250
OH-1004 ID	LXL04_007852
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 87.479 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G227250

Location Chr03:56794339-56797845 (-)

Description Similar to KIN10B: Kinesin-like protein KIN-10B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02370`	Kinesin-like protein KIN-10B.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0459400`	Kinesin-like protein KIN-10C.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007852 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007018 microtubule-based movement Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0051231 spindle elongation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005871 kinesin complex Cellular Component

GO:0005874 microtubule Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003777 microtubule motor activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008017 microtubule binding Molecular Function

KEGG gene cross-reference

dosa:Os05g0459400

xla:100337511

xtr:394855

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.562

Rank 1 · TkA03G227250 · TK1151

Nucleus0.451

Rank 2 · TkA03G227250 · TK1151

Cell membrane0.062

Rank 3 · TkA03G227250 · TK1151

Endoplasmic reticulum0.037

Rank 4 · TkA03G227250 · TK1151

Mitochondrion0.036

Rank 5 · TkA03G227250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16796Microtub_bd36-181 aa

PF00225Kinesin42-350 aa

PF12836HHH_3145-160 aa

PF22038PRC2_EED_ins354-366 aa

PF12826HHH_2456-488 aa

PF04919DUF655458-504 aa

PF12836HHH_3464-511 aa

PF00633HHH464-488 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G227250	`PF16796`	Microtub_bd	36	181	2.8e-15	57.2
TkA03G227250	`PF00225`	Kinesin	42	350	1.3e-83	281.5
TkA03G227250	`PF12836`	HHH_3	145	160	5.4e-06	27.1
TkA03G227250	`PF22038`	PRC2_EED_ins	354	366	1.5	9.6
TkA03G227250	`PF12826`	HHH_2	456	488	0.044	14.7
TkA03G227250	`PF04919`	DUF655	458	504	0.028	15.1
TkA03G227250	`PF12836`	HHH_3	464	511	5.4e-06	27.1
TkA03G227250	`PF00633`	HHH	464	488	0.009	16.5
TkA03G227250	`PF14716`	HHH_8	471	488	0.22	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q5E913`	Arabidopsis thaliana	sp\|Q5E913\|KN10B_ARATH Kinesin-like protein KIN-10B	47.600%	Swiss-Prot	Medium
`Q6L512`	Oryza sativa subsp. japonica	sp\|Q6L512\|KN10C_ORYSJ Kinesin-like protein KIN-10C	47.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card