Gene Card
Gene overview
cDNA / CDS / Protein Sequences
321 bp · TkA03G218870|TK1151|cDNA
ATGAGCCAAATGTTGACCCAAAAGCATAAAATTAGTCGAAATGCAATACGTAGATGGTATGAATATTCAAGGTACTTTTTACAGGATTATTGGCGGAGATGTTGGGTGATTATGCTTTGGATAGGAGTAATGGTTGGTTTATTTACATGGAAGTGGATTCAGTACAAGGACCGAGCAGTATATACGTCTCATATATACCATTCTTGTGTAATTTTACAGGATAGGTTGACCGAAATGCCCAAAAAACAACAAACTGCACC...
321 bp · TkA03G218870|TK1151|CDS
ATGAGCCAAATGTTGACCCAAAAGCATAAAATTAGTCGAAATGCAATACGTAGATGGTATGAATATTCAAGGTACTTTTTACAGGATTATTGGCGGAGATGTTGGGTGATTATGCTTTGGATAGGAGTAATGGTTGGTTTATTTACATGGAAGTGGATTCAGTACAAGGACCGAGCAGTATATACGTCTCATATATACCATTCTTGTGTAATTTTACAGGATAGGTTGACCGAAATGCCCAAAAAACAACAAACTGCACC...
Protein
Download Protein FASTA106 aa · TkA03G218870|TK1151|PROTEIN
MSQMLTQKHKISRNAIRRWYEYSRYFLQDYWRRCWVIMLWIGVMVGLFTWKWIQYKDRAVYTSHIYHSCVILQDRLTEMPKKQQTAPEHHERQSMEKLTKMPIKQH
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G218870 |
|---|---|
| TK1151 ID | TkA03G218870 |
| OH-1004 ID | LXL04_023498 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 78.600 |
| Protein coverage (%) | TK1151 79.245 / OH-1004 47.945Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G218870 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:54826953-54827273 (+) | |||||||||
| Description | Similar to RBOHC: Respiratory burst oxidase homolog protein C | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0007231 osmosensory signaling pathway Biological Process GO:0009408 response to heat Biological Process GO:0009611 response to wounding Biological Process GO:0033500 carbohydrate homeostasis Biological Process GO:0043069 negative regulation of programmed cell death Biological Process GO:0050832 defense response to fungus Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0072593 reactive oxygen species metabolic process Biological Process GO:0005634 nucleus Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005794 Golgi apparatus Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT5G07390 ath:AT5G47910 sot:102586476 sot:102598898 sot:102603596 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.