TkA03G204300 | RubberDandelionOmics

Gene overview

TkA03G204300

Reference: TK1151 Chr: Chr03 Coordinates: 51321163-51322462 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

820 bp · TkA03G204300|TK1151|cDNA

CTTAGAGTTGCAGAACAGAAATTACGATGGCTTCCTCCATATTCTCGCCCGCTTCCTCCTGTGCCATGCTACTTGTTTTTGTATTCCTGTCTTCTATGGCTCAAGGAGACGATATCAATATACCACCTTCTCTCTCTCCTTTCTTCGATAACATCTGCGATCAAGTCAACTGCGGTAAGGGAAATTGCTCCGTTGATCTCAACAAGCCATTTAATTTCGTCTGCCAGTGCGAACCTGGATGGAAGAGGACCCGTTCAGAT...

CDS

Download CDS FASTA

639 bp · TkA03G204300|TK1151|CDS

ATGGCTTCCTCCATATTCTCGCCCGCTTCCTCCTGTGCCATGCTACTTGTTTTTGTATTCCTGTCTTCTATGGCTCAAGGAGACGATATCAATATACCACCTTCTCTCTCTCCTTTCTTCGATAACATCTGCGATCAAGTCAACTGCGGTAAGGGAAATTGCTCCGTTGATCTCAACAAGCCATTTAATTTCGTCTGCCAGTGCGAACCTGGATGGAAGAGGACCCGTTCAGATGACGACGGCGAAGATGATCATCAATT...

Protein

Download Protein FASTA

212 aa · TkA03G204300|TK1151|PROTEIN

MASSIFSPASSCAMLLVFVFLSSMAQGDDINIPPSLSPFFDNICDQVNCGKGNCSVDLNKPFNFVCQCEPGWKRTRSDDDGEDDHQFLPCVIPNCTLDYSCMPAAPPTPPIPDNISIFDPCYWTYCGEGTCTKNLSYSHTCNCNPGYTNLMNTSHFPCFSNCALGTDCRRLGIRVLDATSPSGDESQGTIFLPGRFHWIGITVVSVAMAIWR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G204300`
TK1151 ID	TkA03G204300
OH-1004 ID	LXL04_007678
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G204300`
Location	Chr03:51321163-51322462 (-)
Description	Protein of unknown function
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007678` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	No functional description available
KEGG gene cross-reference	No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.717

Rank 1 · TkA03G204300 · TK1151

Cytoplasm0.106

Rank 2 · TkA03G204300 · TK1151

Endoplasmic reticulum0.106

Rank 3 · TkA03G204300 · TK1151

Extracellular0.099

Rank 4 · TkA03G204300 · TK1151

Nucleus0.058

Rank 5 · TkA03G204300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06247Plasmod_Pvs2844-71 aa

PF14670FXa_inhibition49-73 aa

PF23106EGF_Teneurin49-73 aa

PF12947EGF_360-72 aa

PF12661hEGF61-72 aa

PF12662cEGF64-73 aa

PF23308TSP1_TSH7A-B_C65-72 aa

PF06247Plasmod_Pvs28126-152 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G204300	`PF06247`	Plasmod_Pvs28	44	71	3.5e-05	24.5
TkA03G204300	`PF14670`	FXa_inhibition	49	73	0.23	12.4
TkA03G204300	`PF23106`	EGF_Teneurin	49	73	0.39	11.6
TkA03G204300	`PF12947`	EGF_3	60	72	1.0	10.3
TkA03G204300	`PF12661`	hEGF	61	72	0.0029	18.7
TkA03G204300	`PF12662`	cEGF	64	73	5.2e-05	23.7
TkA03G204300	`PF23308`	TSP1_TSH7A-B_C	65	72	0.033	14.7
TkA03G204300	`PF06247`	Plasmod_Pvs28	126	152	3.5e-05	24.5
TkA03G204300	`PF14670`	FXa_inhibition	126	150	0.23	12.4
TkA03G204300	`PF12661`	hEGF	127	147	0.0029	18.7
TkA03G204300	`PF23106`	EGF_Teneurin	127	148	0.39	11.6
TkA03G204300	`PF12947`	EGF_3	130	148	1.0	10.3
TkA03G204300	`PF12662`	cEGF	138	148	5.2e-05	23.7
TkA03G204300	`PF23308`	TSP1_TSH7A-B_C	138	153	0.033	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card