Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2247 bp · TkA03G200710|TK1151|cDNA
GTTATAACGTTTTAACAGGTTAAATCAAACTTTAAAAAAAAAAAAAAGAGTCCGTTTTAATACACTTACGTATAAGTTAAACACCATCGTACATCCCTGCTTCGGAACTCTTTGCGACGCTGCCGACTATGCCGGTAATGGAAAGATCAGAAATCGGAATTCCGATTTGGCCAGTGAACCCCTCAACCGGTAATCGCCGGAGAGGACCGCTCAGGAGCAGGACTGTTGACACACTTCTTCATATACTGTCCATTTGCTAT...
1815 bp · TkA03G200710|TK1151|CDS
ATGCCGGTAATGGAAAGATCAGAAATCGGAATTCCGATTTGGCCAGTGAACCCCTCAACCGGTAATCGCCGGAGAGGACCGCTCAGGAGCAGGACTGTTGACACACTTCTTCATATACTGTCCATTTGCTATGCCGATTCTTCTCATATCACTCAAAATTCAGATAAGAGCCACACTCTTGAAGAATCAGTCACAAAAGATGATTCAGTAGATAAAGAAGAAACAAATGTGGATGAAACAAAAGTAATTTTAGGTACTCA...
Protein
Download Protein FASTA604 aa · TkA03G200710|TK1151|PROTEIN
MPVMERSEIGIPIWPVNPSTGNRRRGPLRSRTVDTLLHILSICYADSSHITQNSDKSHTLEESVTKDDSVDKEETNVDETKVILGTQEEEFCNTHVEPVEQDHNISEERKDLSSPHLVTDKDVEEGEIAGEFLNLIPEDDVASVDKTGSEHEDFVGIESEFEKNNSLTSLSIDTVDDIGKGMAVVVSKTKRNLVDYSEIALQSNITKSATKNQDFASPVKNNGTQNNKKRPGSCTVEKRTNKKARKSVDQSTCPQDLTTN...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G200710 |
|---|---|
| TK1151 ID | TkA03G200710 |
| OH-1004 ID | LXL04_007640 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G200710 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:50401714-50404957 (-) | ||||||||||||
| Description | Similar to EMB1789: Zinc finger CCCH domain-containing protein 65 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006353 DNA-templated transcription termination Biological Process GO:0032785 negative regulation of DNA-templated transcription, elongation Biological Process GO:0071027 nuclear RNA surveillance Biological Process GO:0110064 lncRNA catabolic process Biological Process GO:0140744 negative regulation of lncRNA transcription Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005694 chromosome Cellular Component GO:0005829 cytosol Cellular Component GO:0001227 DNA-binding transcription repressor activity, RNA polymerase II-specific Molecular Function GO:0003677 DNA binding Molecular Function GO:0003682 chromatin binding Molecular Function | ||||||||||||
| KEGG gene cross-reference | ath:AT5G56930 dosa:Os01g0572100 hsa:23211 mmu:330474 osa:4326353 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF06391MAT148-77 aaPF06391MAT1186-314 aaPF15152Kisspeptin206-239 aaPF16131Torus290-352 aaPF15663zf-CCCH_3324-423 aaPF00642zf-CCCH325-348 aaPF18345zf_CCCH_4329-347 aaPF18044zf-CCCH_4329-348 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G200710 | PF06391 | MAT1 | 48 | 77 | 3.1 | 8.4 |
| TkA03G200710 | PF06391 | MAT1 | 186 | 314 | 3.1 | 8.4 |
| TkA03G200710 | PF15152 | Kisspeptin | 206 | 239 | 4.4 | 8.9 |
| TkA03G200710 | PF16131 | Torus | 290 | 352 | 3.5e-08 | 34.7 |
| TkA03G200710 | PF15663 | zf-CCCH_3 | 324 | 423 | 0.43 | 11.5 |
| TkA03G200710 | PF00642 | zf-CCCH | 325 | 348 | 8.8e-10 | 39.0 |
| TkA03G200710 | PF18345 | zf_CCCH_4 | 329 | 347 | 5.8e-09 | 36.4 |
| TkA03G200710 | PF18044 | zf-CCCH_4 | 329 | 348 | 8.9e-05 | 22.9 |
| TkA03G200710 | PF14608 | zf-CCCH_2 | 329 | 347 | 0.0003 | 21.9 |
| TkA03G200710 | PF25584 | zf-CCCH_RBM22 | 329 | 345 | 2.7 | 8.8 |
| TkA03G200710 | PF25585 | zf-CCCH_DUS3L | 334 | 348 | 0.4 | 11.4 |
| TkA03G200710 | PF29991 | RIPR_EGF-like_10th | 334 | 350 | 6.6 | 7.6 |
| TkA03G200710 | PF22623 | zf-CCCH_9 | 335 | 349 | 2.9e-08 | 34.0 |
| TkA03G200710 | PF23261 | zf-CCCH_11 | 336 | 347 | 5.7 | 7.3 |
| TkA03G200710 | PF00642 | zf-CCCH | 354 | 376 | 8.8e-10 | 39.0 |
| TkA03G200710 | PF16131 | Torus | 355 | 379 | 3.5e-08 | 34.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.