TkA03G193820 | RubberDandelionOmics

Gene overview

TkA03G193820

Reference: TK1151 Chr: Chr03 Coordinates: 48743841-48745342 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1023 bp · TkA03G193820|TK1151|cDNA

TTTGTTATGAAATCAAGGACAAATTAGACATCAAAAAGACCTTGGAGGAGGAAGCCAGAAAATGCCAATGGCTTGTATTGTGGCTTGATTGTGATAGAGAAGGAGAAAACATTGCATTTGAAGTTGTGGAGAAATCCACCAAGCTGCTCAGCAACTTCAACGACCTAATCAGTTATTTTCAGATGATGTTGATGTTAGGAAATTGATCTTCGAATTGGTGCTTCATTCACGAGATTTCAGACAATGTTACTGAAAGATGC...

CDS

Download CDS FASTA

462 bp · TkA03G193820|TK1151|CDS

ATGTTACTGAAAGATGCATTTGTTTTTAATTTTTCTACTGATGGAAGAAACCTTGTTCTAAGTTATGGTCCTTGTGAGTTTCCAACATTAGGATTTGTTGTGGAAAGATATTGGGAGATACAAGCACATGAACCAGAAGAATTTTGGAAGATTCAGTGCACTCATACAGCTGATGAAGACACTTCTACCTTTAATTGGATGCGTGGGCATCTGTTCGATTACACATGTGCAGTATTACTTTATGAAATGTGTCTTCAAGA...

Protein

Download Protein FASTA

153 aa · TkA03G193820|TK1151|PROTEIN

MLLKDAFVFNFSTDGRNLVLSYGPCEFPTLGFVVERYWEIQAHEPEEFWKIQCTHTADEDTSTFNWMRGHLFDYTCAVLLYEMCLQEHMATVTKVRQQEKLKYPPHPLKTIELEKRASRYFRMSSEQTMKVSFVTFSKITPCVQILYQIKEKS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G193820`
TK1151 ID	TkA03G193820
OH-1004 ID	LXL04_033479
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.500
Protein coverage (%)	TK1151 86.275 / OH-1004 14.088 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G193820

Location Chr03:48743841-48745342 (+)

Description Similar to TOP3A: DNA topoisomerase 3-alpha

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g63920`	Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0165000`	Releases the supercoiling and torsional tension of DNA introduced during the DNA replication and transcription by transiently cleaving and rejoining one strand of the DNA duplex.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033479 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0000712 resolution of meiotic recombination intermediates Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006265 DNA topological change Biological Process

GO:0006281 DNA repair Biological Process

GO:0006310 DNA recombination Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0032042 mitochondrial DNA metabolic process Biological Process

GO:0051304 chromosome separation Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0071139 resolution of DNA recombination intermediates Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT5G63920

ddi:DDB_G0275257

dosa:Os03g0165000

hsa:7156

mmu:21975

osa:9269718

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.472

Rank 1 · TkA03G193820 · TK1151

Nucleus0.469

Rank 2 · TkA03G193820 · TK1151

Mitochondrion0.133

Rank 3 · TkA03G193820 · TK1151

Cell membrane0.054

Rank 4 · TkA03G193820 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA03G193820 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01131Topoisom_bac17-131 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G193820	`PF01131`	Topoisom_bac	17	131	8.3e-28	98.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LVP1`	Arabidopsis thaliana	sp\|Q9LVP1\|TOP3A_ARATH DNA topoisomerase 3-alpha	66.900%	Swiss-Prot	High
`C7J0A2`	Oryza sativa subsp. japonica	sp\|C7J0A2\|TOP3A_ORYSJ DNA topoisomerase 3-alpha	73.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card