TkA03G191500 | RubberDandelionOmics

Gene overview

TkA03G191500

Reference: TK1151 Chr: Chr03 Coordinates: 48202311-48207948 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1220 bp · TkA03G191500|TK1151|cDNA

GTTCACTATTAAATCCCTTAGCCGTTTTCGTAAACAGCTACCCACGATGGATGCAAACTTCCGAATTGATTCTTTCTTCTTCACCTTCTCTGACTTTCGTCGTGGATGCTGAAAACCACGATGCCAAAACCGCTCCTTCTATTCAGGCTCCAGTCCCATAGCACCTATAAAACAAATTGAATCCCCTGATTACTAAAATTGCTCGATTCATATGGATTTCAACAGTGAAGTTGTCGGATATATTGGAATTGAGAAGGAAA...

CDS

Download CDS FASTA

684 bp · TkA03G191500|TK1151|CDS

ATGAGTGGAACTGGTATGAACGTGAAGGAACATACCCACGGAAATCAGGGATATCAAAGTTTGGGATTATTATCTATGCATAAATCTCACTACAGAGTTGCTGAATTTCATCCTAAGAGAGGCTCAAGATCAGTGCGTGAACCATATCTTCGAGTTTTGTCGGAAATTGAAAGAGAAGGGAAATTTATCCCAATCACAGCTTTCTTCGAGATGGTTGGCTATGCTCTTAAGGTGGTTGATGGTTTGTGGATTCTTTTAAT...

Protein

Download Protein FASTA

227 aa · TkA03G191500|TK1151|PROTEIN

MSGTGMNVKEHTHGNQGYQSLGLLSMHKSHYRVAEFHPKRGSRSVREPYLRVLSEIEREGKFIPITAFFEMVGYALKVVDGLWILLIVGSCCLITVFMSSSQGHAPQLHRRRTPLRREGNRRRTPLHVSVSLRSSDVRRPLLCLCRCFPPTKDDRRPRFCLATFLRRPTTGDHFRYPFDRYLKYLTKKYLKKHNVRDWLRVIASNKDRNVYELRYFNIAENEGEEED

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G191500`
TK1151 ID	TkA03G191500
OH-1004 ID	LXL04_007573
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.000
Protein coverage (%)	TK1151 91.189 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G191500

Location Chr03:48202311-48207948 (-)

Description Similar to RPL22B: 60S ribosomal protein L22-2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g05560`	Large ribosomal subunit protein eL22z.	No verified direct reference in this release
`At5g27770`	Large ribosomal subunit protein eL22y.	No verified direct reference in this release
`At1g02830`	Large ribosomal subunit protein eL22x.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007573 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002181 cytoplasmic translation Biological Process

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0022625 cytosolic large ribosomal subunit Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0030684 preribosome Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G05560

cel:CELE_C27A2.2

ddi:DDB_G0288101

ddi:DDB_G0290091

spo:2543021

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.435

Rank 1 · TkA03G191500 · TK1151

Cytoplasm0.364

Rank 2 · TkA03G191500 · TK1151

Mitochondrion0.132

Rank 3 · TkA03G191500 · TK1151

Cell membrane0.123

Rank 4 · TkA03G191500 · TK1151

Endoplasmic reticulum0.087

Rank 5 · TkA03G191500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01776Ribosomal_L22e180-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G191500	`PF01776`	Ribosomal_L22e	180	226	1.1e-17	65.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9W1`	Arabidopsis thaliana	sp\|Q9M9W1\|RL222_ARATH Large ribosomal subunit protein eL22z	95.800%	Swiss-Prot	Low
`Q9FE58`	Arabidopsis thaliana	sp\|Q9FE58\|RL223_ARATH Large ribosomal subunit protein eL22y	93.800%	Swiss-Prot	Low
`Q9SRX7`	Arabidopsis thaliana	sp\|Q9SRX7\|RL221_ARATH Large ribosomal subunit protein eL22x	87.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card