TkA03G186940 | RubberDandelionOmics

Gene overview

TkA03G186940

Reference: TK1151 Chr: Chr03 Coordinates: 47069294-47072261 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1919 bp · TkA03G186940|TK1151|cDNA

AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAACTAAAAGTGAATATAAATTAAAAATTAAAACACAAACACAAAGTTCTGTTAACTATTATATGGTAAGAAAAGCAAACCGGAATTGTGAGTTACCGAAAAAGAAGACCTCAAACTCCAGTATCCAACTCTTTTTAATCAGGAAATCTAAAATATGAACTAAATCTGAACTCTTTCAAACGGAAAACAGTGAATCGCAAGATCAGAAACGGGAGAATAGGAATATTGAA...

CDS

Download CDS FASTA

573 bp · TkA03G186940|TK1151|CDS

ATGACTAGCAGTTCAAAGTGTGTTAATATAATAGATGTGGATAAATATGAAGATGCAAAGTATGATATTATAGATTTAGATAAAGATGAAGTTGTAGATGATTTCTACATGTATGACGAGGATGAGCTGTTACTGATTTCCGCTGAGAAGTATACCCACAACTCGCAAAAAGATAATAAATTGAAGAGGAAACAGGCAATGGTGAGATGGAGCTTTTGTGGCATTTGTATGGACACAAAGTCTGGATCAGAAATGTTTTC...

Protein

Download Protein FASTA

190 aa · TkA03G186940|TK1151|PROTEIN

MTSSSKCVNIIDVDKYEDAKYDIIDLDKDEVVDDFYMYDEDELLLISAEKYTHNSQKDNKLKRKQAMVRWSFCGICMDTKSGSEMFSNPKVCGHLFCLDCIRQHVSVKIQENVAMVKCPDPTCKSLIGPEVCGSIVPKQVLERWEDALCESWIVKKFYCPFKDCSAMLVDDSGKVVTSSECPNCNRLFCA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G186940`
TK1151 ID	TkA03G186940
OH-1004 ID	LXL04_007527
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 98.421 / OH-1004 56.495 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G186940`
Location	Chr03:47069294-47072261 (-)
Description	Similar to ARI10: Probable E3 ubiquitin-protein ligase ARI10
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007527` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000209 protein polyubiquitination Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009738 abscisic acid-activated signaling pathway Biological Process GO:0009740 gibberellic acid mediated signaling pathway Biological Process GO:0009788 negative regulation of abscisic acid-activated signaling pathway Biological Process GO:0010431 seed maturation Biological Process GO:0010476 gibberellin mediated signaling pathway Biological Process GO:0016567 protein ubiquitination Biological Process GO:0140547 acquisition of seed longevity Biological Process GO:0000151 ubiquitin ligase complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	ath:AT1G05890 ath:AT2G26130 ath:AT2G31760 ath:AT2G31770 ath:AT3G27710 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.946

Rank 1 · TkA03G186940 · TK1151

Cytoplasm0.149

Rank 2 · TkA03G186940 · TK1151

Cell membrane0.023

Rank 3 · TkA03G186940 · TK1151

Endoplasmic reticulum0.019

Rank 4 · TkA03G186940 · TK1151

Mitochondrion0.009

Rank 5 · TkA03G186940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01485IBR6-15 aa

PF06044DpnI48-104 aa

PF30548DciA_cyano_C67-77 aa

PF25454zf-C3HC4_IRF-2BP1_272-120 aa

PF13445zf-RING_UBOX73-119 aa

PF01485IBR73-103 aa

PF00097zf-C3HC473-119 aa

PF13639zf-RING_273-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G186940	`PF01485`	IBR	6	15	4.3e-05	24.2
TkA03G186940	`PF06044`	DpnI	48	104	0.037	14.4
TkA03G186940	`PF30548`	DciA_cyano_C	67	77	0.22	11.8
TkA03G186940	`PF25454`	zf-C3HC4_IRF-2BP1_2	72	120	0.0039	18.1
TkA03G186940	`PF13445`	zf-RING_UBOX	73	119	2.1e-06	28.3
TkA03G186940	`PF01485`	IBR	73	103	4.3e-05	24.2
TkA03G186940	`PF00097`	zf-C3HC4	73	119	5.7e-05	23.6
TkA03G186940	`PF13639`	zf-RING_2	73	119	0.00027	21.8
TkA03G186940	`PF24921`	RING_XB3-XBAT31	73	123	0.0047	17.7
TkA03G186940	`PF13923`	zf-C3HC4_2	73	104	0.014	15.9
TkA03G186940	`PF14634`	zf-RING_5	73	124	0.053	14.2
TkA03G186940	`PF17123`	zf-RING_11	73	101	0.18	12.2
TkA03G186940	`PF15227`	zf-C3HC4_4	92	106	5.0	8.0
TkA03G186940	`PF01485`	IBR	109	129	4.3e-05	24.2
TkA03G186940	`PF30548`	DciA_cyano_C	132	145	0.22	11.8
TkA03G186940	`PF01485`	IBR	143	189	4.3e-05	24.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card