TkA03G178360 | RubberDandelionOmics

Gene overview

TkA03G178360

Reference: TK1151 Chr: Chr03 Coordinates: 45036150-45037763 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA03G178360|TK1151|cDNA

ATGAGTAGTAGTTCAGGGAGACAAGTGAAGGCTATGCTTCGGAAGAACTGGCTTCTCAAAATTCGTCATCCTTATATCACACTTGCGGAGATGAATGTGGAGGCCTATGTTTGGCTTTGTGGCTTTTCAGAAAAAGTTGGGACAGCAAAAAGAAAACAAAATGATGTGGAGGCTTATGTTTCGCTTTCTGGCTTTTCAGAAAAAAGGTGGGACAGCAAAAAGAAGACAAATTCGCTCATCTACTGCCACATCTCGCAACT...

CDS

Download CDS FASTA

432 bp · TkA03G178360|TK1151|CDS

ATGAGTAGTAGTTCAGGGAGACAAGTGAAGGCTATGCTTCGGAAGAACTGGCTTCTCAAAATTCGTCATCCTTATATCACACTTGCGGAGATGAATGTGGAGGCCTATGTTTGGCTTTGTGGCTTTTCAGAAAAAGTTGGGACAGCAAAAAGAAAACAAAATGATGTGGAGGCTTATGTTTCGCTTTCTGGCTTTTCAGAAAAAAGGTGGGACAGCAAAAAGAAGACAAATTCGCTCATCTACTGCCACATCTCGCAACT...

Protein

Download Protein FASTA

143 aa · TkA03G178360|TK1151|PROTEIN

MSSSSGRQVKAMLRKNWLLKIRHPYITLAEMNVEAYVWLCGFSEKVGTAKRKQNDVEAYVSLSGFSEKRWDSKKKTNSLIYCHISQLRYRHNSLTYISDSAQQPNPPHCQLYVALFRGISGKNTKVLVKTVKELLMHEFTHPK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G178360`
TK1151 ID	TkA03G178360
OH-1004 ID	LXL04_034146
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	74.100
Protein coverage (%)	TK1151 37.762 / OH-1004 19.708 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G178360

Location Chr03:45036150-45037763 (+)

Description Similar to Transposon TX1 uncharacterized 149 kDa protein

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41700`	ABC transporter A family member 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034146 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006869 lipid transport Biological Process

GO:0032197 retrotransposition Biological Process

GO:0090304 nucleic acid metabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0016020 membrane Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003824 catalytic activity Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0005319 lipid transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G41700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.345

Rank 1 · TkA03G178360 · TK1151

Nucleus0.320

Rank 2 · TkA03G178360 · TK1151

Mitochondrion0.216

Rank 3 · TkA03G178360 · TK1151

Cell membrane0.132

Rank 4 · TkA03G178360 · TK1151

Endoplasmic reticulum0.119

Rank 5 · TkA03G178360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84M24`	Arabidopsis thaliana	sp\|Q84M24\|AB1A_ARATH ABC transporter A family member 1	63.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card