Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2418 bp · TkA03G178140|TK1151|cDNA
GCGCATTGCGCCTCTCGTTCCTTTCTAACTTTATTTTCTCTTTTTGGTCACCACTCACTCATCACTGAACTGTGAGCACAATCTAAACCACTCTCAGAAAGACCTAAAGCTTACATTCATACGTATACATACATCTCTGCTTAGTTCTCTCTCACACAATTACTCCTCTGTTCTACTACACCAGTCCGAGATCTCATCCCTTTCATTCACTACCGCATTGCATTTACTTCGATTCAAGTTGCCAAATATATCGCCATGGA...
1164 bp · TkA03G178140|TK1151|CDS
ATGCAGGATAATGATCAGAATGAATACAATCCATCTCACTCAAACACAAGCAAAAGCATCACATGCAGCCATCAGTTATGTGAAATGGGCCCCACTTGCAAAAACCCTAAGCAGCCATGCCCCTACATTGTCAAGTATGCCTCTACAGATACATCCAGTTCTGGATCACTCGTTGAAGACATTCTGCATCTCGCATCTGATGCTAGTAACATTAATGGATCCAACATGTATGTACGGGCTCCAGTTATCATAGGGTGTGG...
Protein
Download Protein FASTA387 aa · TkA03G178140|TK1151|PROTEIN
MQDNDQNEYNPSHSNTSKSITCSHQLCEMGPTCKNPKQPCPYIVKYASTDTSSSGSLVEDILHLASDASNINGSNMYVRAPVIIGCGREQSGGYLDGIAPDGVLGLGLGDVSIPSLLAKSGVTKNAFSLCFGEGGSGNIYFGDEGPPTQKTTPFLPLDGKYAAYIIGVERFCIGSSCLDETNFNAQFDSGTTFTSLPDDVYKAVVKEFDRQANATRVDHEDLPFEYCYKSSSEELPDTPLVTIKVAVNNIFVVHDPLFVL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G178140 |
|---|---|
| TK1151 ID | TkA03G178140 |
| OH-1004 ID | LXL04_007448 |
| Relationship / confidence | Rbh Below Probable Coverage Or Synteny Threshold / Review |
| Protein identity (%) | 99.000 |
| Protein coverage (%) | TK1151 99.483 / OH-1004 60.440Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G178140 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:44975882-44979078 (-) | |||||||||
| Description | Similar to At5g10080: Aspartic proteinase-like protein 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006508 proteolysis Biological Process GO:0009555 pollen development Biological Process GO:0009846 pollen germination Biological Process GO:0009860 pollen tube growth Biological Process GO:0010183 pollen tube guidance Biological Process GO:0030163 protein catabolic process Biological Process GO:0050832 defense response to fungus Biological Process GO:0005576 extracellular region Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G49050 ath:AT1G65240 ath:AT2G17760 ath:AT5G10080 ath:AT5G36260 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF14543TAXi_N5-143 aaPF00026Asp95-305 aaPF14541TAXi_C180-306 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G178140 | PF14543 | TAXi_N | 5 | 143 | 1.2e-25 | 91.4 |
| TkA03G178140 | PF00026 | Asp | 95 | 305 | 2e-12 | 47.9 |
| TkA03G178140 | PF14541 | TAXi_C | 180 | 306 | 4.7e-17 | 63.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.