RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G175390
Reference: TK1151 Chr: Chr03 Coordinates: 44221209-44224672 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2037 bp · TkA03G175390|TK1151|cDNA

TGAAAACAATCTTACTCCTAATACATGAATGCATAACAAAAGTGAATCGAGTTAACTTTTCAATATCCAAATAGTAAGTAAATGCAAACCAAAGAACGCTAGTTCTAGGATGAAGCGTAATACCTTCAAACATAACTATCCCATTATATTATAGGAACATGGTTGATGACCGGATGTACCACATTCTTATATGTATGAAGTTTAGCAATCATGATCTCTTTGGACTTAATGGCTATGTGGATGTAGTGGTTCTTCAGTTG...

CDS

Download CDS FASTA

681 bp · TkA03G175390|TK1151|CDS

ATGGAAGTGTTTACCGGCGACCATGGGCTGCCAAGCGACGGCGTCCTCTTCCCGGATACACACCTATCTCCCTTTTCTCTACCCACAACCGATACCTTTACCGATCAGCATAAAATCTCAATCGACCACCACCATCTTCTTCCCCCGCAGCCGCCGCAAAAGCTCCGTCCAATTAGATGCAATGGACGCAGTTTTACTGACTGTTGCTCCTCAGATGATCCCCTTGATACAAAGCCGCTTAGCTGGCAGCCGGAGATTGG...

Protein

Download Protein FASTA

226 aa · TkA03G175390|TK1151|PROTEIN

MEVFTGDHGLPSDGVLFPDTHLSPFSLPTTDTFTDQHKISIDHHHLLPPQPPQKLRPIRCNGRSFTDCCSSDDPLDTKPLSWQPEIGFYDTEIGDASFIPSKASALGLSTKECQTEAVLSITYAKLVLYLLLFLLYLNGNEIYDPNNNLEEVEFDSNMKRWPKSEVQALITVRAALNQKFTGKGAKGSVWEEAGPAQGLGELGHSPGHQHREGHQIGVNSYGYIFF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G175390
TK1151 IDTkA03G175390
OH-1004 IDLXL04_009962
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)56.700
Protein coverage (%)TK1151 90.708 / OH-1004 81.794
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G175390
LocationChr03:44221209-44224672 (-)
DescriptionSimilar to GT-2: Trihelix transcription factor GT-2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_009962 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0019760 glucosinolate metabolic process Biological Process
GO:0045893 positive regulation of DNA-templated transcription Biological Process
GO:0048354 mucilage biosynthetic process involved in seed coat development Biological Process
GO:0048358 mucilage pectin biosynthetic process Biological Process
GO:0048768 root hair cell tip growth Biological Process
GO:0005634 nucleus Cellular Component
GO:0000976 transcription cis-regulatory region binding Molecular Function
GO:0000987 cis-regulatory region sequence-specific DNA binding Molecular Function
GO:0003700 DNA-binding transcription factor activity Molecular Function
GO:0005516 calmodulin binding Molecular Function
KEGG gene cross-reference
ath:AT1G76880
ath:AT1G76890
ath:AT5G28300
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.384
Rank 1 · TkA03G175390 · TK1151
Nucleus0.356
Rank 2 · TkA03G175390 · TK1151
Cytoplasm0.145
Rank 3 · TkA03G175390 · TK1151
Endoplasmic reticulum0.080
Rank 4 · TkA03G175390 · TK1151
Mitochondrion0.076
Rank 5 · TkA03G175390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13837Myb_DNA-bind_4159-192 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA03G175390PF13837Myb_DNA-bind_41591920.01416.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser