TkA03G162280 | RubberDandelionOmics

Gene overview

TkA03G162280

Reference: TK1151 Chr: Chr03 Coordinates: 41168963-41170060 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1053 bp · TkA03G162280|TK1151|cDNA

ATGTGTCCCCGCAACAATCTTCCGCCGGATTATATCGAAGCAATACTGCGGCGTCTGCCGGCCAAATCCCTCGGCCGCTTTAAGTCCGTATCAAAGCAATGGTGCTCGCTAATTTCAGAACCCCGATTCATCAAAACCCATCTCCGTCTACAAAATCACCATAAAACCAGTAAATTGATTTTCGTCTCCGATACAACCTCTCTGTACTCACTCGATATTAACGAAATCGTTCCACATCTCAACAGTAGCGACGACATACC...

CDS

Download CDS FASTA

1053 bp · TkA03G162280|TK1151|CDS

ATGTGTCCCCGCAACAATCTTCCGCCGGATTATATCGAAGCAATACTGCGGCGTCTGCCGGCCAAATCCCTCGGCCGCTTTAAGTCCGTATCAAAGCAATGGTGCTCGCTAATTTCAGAACCCCGATTCATCAAAACCCATCTCCGTCTACAAAATCACCATAAAACCAGTAAATTGATTTTCGTCTCCGATACAACCTCTCTGTACTCACTCGATATTAACGAAATCGTTCCACATCTCAACAGTAGCGACGACATACC...

Protein

Download Protein FASTA

350 aa · TkA03G162280|TK1151|PROTEIN

MCPRNNLPPDYIEAILRRLPAKSLGRFKSVSKQWCSLISEPRFIKTHLRLQNHHKTSKLIFVSDTTSLYSLDINEIVPHLNSSDDIPATGNEINFRPPSIAWEGILGSCNELVLARDEDDRLYLINPTTREISKLPISPFALPIGEGFQITISFWDTDNEHNPDCSDMLVSVYTLSTNSWRKLPDSPYDHAVGHLVSGVLVNGSLHWLTKTRPSYSSTIIAFSLANEKFNEIELPDSIDNDKAVFKELAVIGGKLCFCNQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G162280`
TK1151 ID	TkA03G162280
OH-1004 ID	LXL04_007358
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	79.600
Protein coverage (%)	TK1151 97.714 / OH-1004 96.995 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G162280

Location Chr03:41168963-41170060 (+)

Description Similar to At3g06240: F-box/kelch-repeat protein At3g06240

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06240`	F-box/kelch-repeat protein At3g06240.	No verified direct reference in this release
`At4g19940`	F-box protein At4g19940.	No verified direct reference in this release
`At3g52320`	Putative F-box protein At3g52320.	No verified direct reference in this release
`At2g43270`	F-box/kelch-repeat protein At2g43270.	No verified direct reference in this release
`At2g43440`	F-box protein At2g43440.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007358 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0008284 positive regulation of cell population proliferation Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0042177 negative regulation of protein catabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0009506 plasmodesma Cellular Component

KEGG gene cross-reference

ath:AT3G06240

ath:AT3G07870

ath:AT3G23880

ath:AT4G12560

ath:AT4G22390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.627

Rank 1 · TkA03G162280 · TK1151

Nucleus0.440

Rank 2 · TkA03G162280 · TK1151

Cell membrane0.103

Rank 3 · TkA03G162280 · TK1151

Endoplasmic reticulum0.063

Rank 4 · TkA03G162280 · TK1151

Lysosome / Vacuole0.037

Rank 5 · TkA03G162280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box6-44 aa

PF12937F-box-like6-43 aa

PF07734FBA_186-345 aa

PF03478Beta-prop_KIB1-496-260 aa

PF23635Beta-prop_AT5G49610-like109-128 aa

PF08268FBA_3121-284 aa

PF24981Beta-prop_ATRN-LZTR1159-250 aa

PF07646Kelch_2160-187 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G162280	`PF00646`	F-box	6	44	1.5e-08	34.9
TkA03G162280	`PF12937`	F-box-like	6	43	3.8e-06	27.3
TkA03G162280	`PF07734`	FBA_1	86	345	1.4e-14	54.5
TkA03G162280	`PF03478`	Beta-prop_KIB1-4	96	260	1.2e-05	25.7
TkA03G162280	`PF23635`	Beta-prop_AT5G49610-like	109	128	0.031	14.2
TkA03G162280	`PF08268`	FBA_3	121	284	5.5e-11	42.8
TkA03G162280	`PF24981`	Beta-prop_ATRN-LZTR1	159	250	0.11	12.4
TkA03G162280	`PF07646`	Kelch_2	160	187	0.022	15.4
TkA03G162280	`PF23635`	Beta-prop_AT5G49610-like	162	242	0.031	14.2
TkA03G162280	`PF07646`	Kelch_2	199	223	0.022	15.4
TkA03G162280	`PF24981`	Beta-prop_ATRN-LZTR1	247	283	0.11	12.4
TkA03G162280	`PF12937`	F-box-like	319	323	3.8e-06	27.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GXC7`	Arabidopsis thaliana	sp\|Q8GXC7\|FBK50_ARATH F-box/kelch-repeat protein At3g06240	29.800%	Swiss-Prot	Low
`O49421`	Arabidopsis thaliana	sp\|O49421\|FB238_ARATH F-box protein At4g19940	24.900%	Swiss-Prot	Low
`Q9FT50`	Arabidopsis thaliana	sp\|Q9FT50\|FB202_ARATH Putative F-box protein At3g52320	26.900%	Swiss-Prot	Low
`Q1PEU9`	Arabidopsis thaliana	sp\|Q1PEU9\|FBK43_ARATH F-box/kelch-repeat protein At2g43270	28.100%	Swiss-Prot	Low
`A8MS20`	Arabidopsis thaliana	sp\|A8MS20\|FB350_ARATH F-box protein At2g43440	23.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card