Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1762 bp · TkA03G152250|TK1151|cDNA
AAGAGACACCAACCCCTCTCCTTGCAGAGGTTTACGCAGAGAAAGTTGATAGAACAGGGGGAGATGATATTGAGATGAAGATGCTTCCGAGAGAACTCCAAGTCCATGAAAACAGAGTAATTCAGAGTTTGATCAGAATATTAAGATCTCAGAATCACGCCCTTCATTTCACGAAGATCCTTTGAACCTTCTATATATAGATATAATTAAGGACACCAAGATACAGTTTAGTGTGCGATGAGCGTTATCAATCAAACAAA...
1242 bp · TkA03G152250|TK1151|CDS
ATGGCGGCAGCTTGGGATCATTTGGGGGAAATCGCAAATGTGGCCCAGCTAACAGGTTTCGATGCGGTTAAACTAATCGGAATGATCATAAAAGCCGCAAGCACAGCTCGATTACACAAAAAGAACTGCAAACAATTCGCAATGCATTTGAGGTTGATTGGAAATCTTTTAGCACAACTGAAAATTAGTGAACTCAAGAAGTATCCAGAAACCCGTGAACCTTTAGAGCAACTTGAAGATGCATTAAGAAGATCATATAT...
Protein
Download Protein FASTA413 aa · TkA03G152250|TK1151|PROTEIN
MAAAWDHLGEIANVAQLTGFDAVKLIGMIIKAASTARLHKKNCKQFAMHLRLIGNLLAQLKISELKKYPETREPLEQLEDALRRSYILVNSCQDRSYFYVLTMGWTIVYQFKKAQDEIDRYLKIIPLITLVDNSRVTQERLEYIEMDQNEYTLEEEDRRVQEVIMKPDPYNTDNNSGLRRSLSFSYPDVPFNEVIKKENEKLQIELQHSQSYLDVSQCEMIQNLMEVVDVFTLNSQYENDMAYYPYAITNKQHEVRNDVQ...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G152250 |
|---|---|
| TK1151 ID | TkA03G152250 |
| OH-1004 ID | LXL04_007303 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.800 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G152250 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:38654611-38657597 (-) | |||||||||
| Description | Similar to MCA1: Protein MID1-COMPLEMENTING ACTIVITY 1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006816 calcium ion transport Biological Process GO:0006979 response to oxidative stress Biological Process GO:0007166 cell surface receptor signaling pathway Biological Process GO:0007231 osmosensory signaling pathway Biological Process GO:0033500 carbohydrate homeostasis Biological Process GO:0048528 post-embryonic root development Biological Process GO:0071260 cellular response to mechanical stimulus Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0016020 membrane Cellular Component GO:0005262 calcium channel activity Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G14870 ath:AT2G17780 ath:AT4G35920 ath:AT5G35525 zma:100192784 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF25055DUF779224-120 aaPF19584MCAfunc25-167 aaPF04749PLAC881-95 aaPF19584MCAfunc219-234 aaPF04749PLAC8291-388 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G152250 | PF25055 | DUF7792 | 24 | 120 | 0.00058 | 20.7 |
| TkA03G152250 | PF19584 | MCAfunc | 25 | 167 | 4.6e-77 | 257.3 |
| TkA03G152250 | PF04749 | PLAC8 | 81 | 95 | 1.3e-19 | 71.7 |
| TkA03G152250 | PF19584 | MCAfunc | 219 | 234 | 4.6e-77 | 257.3 |
| TkA03G152250 | PF04749 | PLAC8 | 291 | 388 | 1.3e-19 | 71.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.