RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA03G146870
Reference: TK1151 Chr: Chr03 Coordinates: 37427954-37428918 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

940 bp · TkA03G146870|TK1151|cDNA

CTACTCTCACAGATCGCAGATCGCTCTCGTCTCCTGCTTCCAAATCCGAATCTTGTTGCTCCACTTCATCCGGCGACTTCACCTCGGCTACAGCAGTCCTGTCTCCGTCGCTGCTCCGTCTCGCCCTACCGTCGCTGCTCCATAGCCGTCGGGATTTCCTCCACAGGCGCTCGTCGAGATCCATTCCTCCACAGGCGCTCGTCGACTGCTCCACTTCATCCGACGACTTCACACCGACTGCTCCACTTCATCTGCCGTTC...

CDS

Download CDS FASTA

429 bp · TkA03G146870|TK1151|CDS

CTACTCTCACAGATCGCAGATCGCTCTCGTCTCCTGCTTCCAAATCCGAATCTTGTTGCTCCACTTCATCCGGCGACTTCACCTCGGCTACAGCAGTCCTGTCTCCGTCGCTGCTCCGTCTCGCCCTACCGTCGCTGCTCCATAGCCGTCGGGATTTCCTCCACAGGCGCTCGTCGAGATCCATTCCTCCACAGGCGCTCGTCGACTGCTCCACTTCATCCGACGACTTCACACCGACTGCTCCACTTCATCTGCCGTTC...

Protein

Download Protein FASTA

142 aa · TkA03G146870|TK1151|PROTEIN

LLSQIADRSRLLLPNPNLVAPLHPATSPRLQQSCLRRCSVSPYRRCSIAVGISSTGARRDPFLHRRSSTAPLHPTTSHRLLHFICRSSSPSQGATATASSPSPISRQARQLHLHLRFLHLIVSSISASDLLTYCFCFNHYEH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA03G146870
TK1151 IDTkA03G146870
OH-1004 IDLXL04_030206
Relationship / confidenceNon Reciprocal Best Hit / Complex relationship
Protein identity (%)51.100
Protein coverage (%)TK1151 90.845 / OH-1004 15.692
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA03G146870
LocationChr03:37427954-37428918 (+)
DescriptionSimilar to HAP2: Protein HAPLESS 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

No hit for this species in the current source table.

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_030206 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0002943 tRNA dihydrouridine synthesis Biological Process
GO:0009567 double fertilization forming a zygote and endosperm Biological Process
GO:0010183 pollen tube guidance Biological Process
GO:0045026 plasma membrane fusion Biological Process
GO:0048235 pollen sperm cell differentiation Biological Process
GO:0061936 fusion of sperm to egg plasma membrane involved in double fertilization forming a zygote and endosperm Biological Process
GO:0140374 antiviral innate immune response Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005783 endoplasmic reticulum Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference
ath:AT4G11720
dosa:Os05g0269500
dosa:Os09g0525700
hsa:54920
mmu:66369
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.582
Rank 1 · TkA03G146870 · TK1151
Cytoplasm0.402
Rank 2 · TkA03G146870 · TK1151
Cell membrane0.112
Rank 3 · TkA03G146870 · TK1151
Endoplasmic reticulum0.087
Rank 4 · TkA03G146870 · TK1151
Mitochondrion0.025
Rank 5 · TkA03G146870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser