TkA03G146310 | RubberDandelionOmics

Gene overview

TkA03G146310

Reference: TK1151 Chr: Chr03 Coordinates: 37287527-37287958 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

432 bp · TkA03G146310|TK1151|cDNA

ATGTCCGAAGAAACCGCGTTCAAAAAAGAAGCGGAATTACTCGGAAAAATCCGCCACCGAAATCTAACCGTCCTTCGCGGATACTACGCGGGCCCACCCGACCTCCGCCTGTTAGTATACGACTACATGCCAAACGGAAACCTAGCAACCCTGCTCCAAGAAGCATCACATCAAGATGGGCATGTTTTGAATTGGCCCATGAGACATTTAATCGCGCTAGGGATAGCCCGAGGGGTAGGGTTTCTCCATTCGACTGCGAC...

CDS

Download CDS FASTA

432 bp · TkA03G146310|TK1151|CDS

ATGTCCGAAGAAACCGCGTTCAAAAAAGAAGCGGAATTACTCGGAAAAATCCGCCACCGAAATCTAACCGTCCTTCGCGGATACTACGCGGGCCCACCCGACCTCCGCCTGTTAGTATACGACTACATGCCAAACGGAAACCTAGCAACCCTGCTCCAAGAAGCATCACATCAAGATGGGCATGTTTTGAATTGGCCCATGAGACATTTAATCGCGCTAGGGATAGCCCGAGGGGTAGGGTTTCTCCATTCGACTGCGAC...

Protein

Download Protein FASTA

143 aa · TkA03G146310|TK1151|PROTEIN

MSEETAFKKEAELLGKIRHRNLTVLRGYYAGPPDLRLLVYDYMPNGNLATLLQEASHQDGHVLNWPMRHLIALGIARGVGFLHSTATVHGDIKPQNVLSSTGFRSARFRIRAQCPRRSIAGKRCFNRVCFAGGGVDWGGYAGI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G146310`
TK1151 ID	TkA03G146310
OH-1004 ID	LXL04_007247
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.100
Protein coverage (%)	TK1151 72.028 / OH-1004 9.131 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G146310

Location Chr03:37287527-37287958 (+)

Description Similar to At4g36180: Probable LRR receptor-like serine/threonine-protein kinase At4g36180

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36180`	Probable LRR receptor-like serine/threonine-protein kinase At4g36180.	No verified direct reference in this release
`At3g24660`	Does not seem to have conserved a kinase activity.	No verified direct reference in this release
`At3g56100`	Can phosphorylate AGL24.	No verified direct reference in this release
`At5g01550`	Involved in negative regulation of abscisic acid response in seed germination.	The Arabidopsis A4 subfamily of lectin receptor kinases negatively regulates abscisic acid response in seed germination.2009 · DOI: 10.1104/pp.108.130583

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0576900`	Functions in the early stages of organ development by regulating cell division rate.	XIAO is involved in the control of organ size by contributing to the regulation of signaling and homeostasis of brassinosteroids and cell cycling in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04877.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007247 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009553 embryo sac development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0010234 anther wall tapetum cell fate specification Biological Process

GO:0042659 regulation of cell fate specification Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0090696 post-embryonic plant organ development Biological Process

GO:0090708 specification of plant organ axis polarity Biological Process

GO:0160073 Casparian strip assembly Biological Process

GO:2000067 regulation of root morphogenesis Biological Process

GO:2000280 regulation of root development Biological Process

KEGG gene cross-reference

ath:AT4G36180

ath:AT5G07280

ath:AT5G44700

dosa:Os04g0576900

osa:4336741

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.515

Rank 1 · TkA03G146310 · TK1151

Nucleus0.383

Rank 2 · TkA03G146310 · TK1151

Cell membrane0.160

Rank 3 · TkA03G146310 · TK1151

Mitochondrion0.081

Rank 4 · TkA03G146310 · TK1151

Endoplasmic reticulum0.065

Rank 5 · TkA03G146310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr3-100 aa

PF00069Pkinase4-100 aa

PF19974TCAD950-100 aa

PF06293Kdo58-103 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G146310	`PF07714`	PK_Tyr_Ser-Thr	3	100	1.4e-13	51.5
TkA03G146310	`PF00069`	Pkinase	4	100	9.6e-13	48.8
TkA03G146310	`PF19974`	TCAD9	50	100	0.047	13.6
TkA03G146310	`PF06293`	Kdo	58	103	0.15	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGS2`	Arabidopsis thaliana	sp\|C0LGS2\|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180	84.000%	Swiss-Prot	Medium
`P33543`	Arabidopsis thaliana	sp\|P33543\|TMKL1_ARATH Putative kinase-like protein TMKL1	47.300%	Swiss-Prot	Medium
`C0LGP9`	Arabidopsis thaliana	sp\|C0LGP9\|IMK3_ARATH Probable leucine-rich repeat receptor-like protein kinase IMK3	47.300%	Swiss-Prot	Medium
`Q9M020`	Arabidopsis thaliana	sp\|Q9M020\|LRK63_ARATH Lectin-domain containing receptor kinase VI.3	48.400%	Swiss-Prot	Medium
`G9LZD7`	Oryza sativa subsp. japonica	sp\|G9LZD7\|XIAO_ORYSJ Probable inactive leucine-rich repeat receptor kinase XIAO	77.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card