Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1575 bp · TkA03G139010|TK1151|cDNA
ATGGATAGAGAGTGTTGTTGAGTGTTGCGAAAAAAAAAAAAATTTTGTTGTAGTAGAGTAGTCGGTAGATTTTGTAAAATGTTTCGATAACTTTACATGAATTAAAAGATTCTAACATTTTGGCAAGAAAGGACTAAAATTCAAAGCTTTCAACGGTCCAATCTCCATACCAGTATGCTTCGATGTCCTAAATTCCCCGTCAATCGCCTTGCGGGATATATTCTTCGCCAACTCGCTGTCCAAGTTAATCAGCTTCGTGC...
1098 bp · TkA03G139010|TK1151|CDS
ATGCTTCGATGTCCTAAATTCCCCGTCAATCGCCTTGCGGGATATATTCTTCGCCAACTCGCTGTCCAAGTTAATCAGCTTCGTGCGAAATCCGGCCGTCCTCCTTTCAAGAACAGATACGACGACAACGACGAGGACGATAACAATGGTTATATCCGAAAGAGAAAGGACAATCAGGAGGATCGTTTACAGCTATACAAAAGCAGGGGGCAACATCTTTTAACCAACACCCGAATCCTCGATTCCATTGTTAAGAACTC...
Protein
Download Protein FASTA365 aa · TkA03G139010|TK1151|PROTEIN
MLRCPKFPVNRLAGYILRQLAVQVNQLRAKSGRPPFKNRYDDNDEDDNNGYIRKRKDNQEDRLQLYKSRGQHLLTNTRILDSIVKNSGVGPADTVLEIGPGTGNLTLKLLEVAHKVVAVEVDNRMVQVLQTRVSEHGLAEKLTIISEDALKTDFLHFDLVVANIPYGISSPLIAKLVFGGYKFRSATLLLQKEFAIRLLANPGDSDFNRLAVNVKLVADIDHVMNVSKKEFVPIPKVDSSVVKIRLKTEIPDVDLNEWWA...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G139010 |
|---|---|
| TK1151 ID | TkA03G139010 |
| OH-1004 ID | LXL04_026767 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 30.500 |
| Protein coverage (%) | TK1151 66.575 / OH-1004 76.401Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G139010 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:35622241-35623883 (-) | |||||||||
| Description | Similar to PFC1: Ribosomal RNA small subunit methyltransferase, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009409 response to cold Biological Process GO:0031167 rRNA methylation Biological Process GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component GO:0000179 rRNA (adenine-N6,N6-)-dimethyltransferase activity Molecular Function GO:0003723 RNA binding Molecular Function GO:0016422 mRNA (2'-O-methyladenosine-N6-)-methyltransferase activity Molecular Function GO:0052908 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase activity Molecular Function | |||||||||
| KEGG gene cross-reference | ana:alr3229 ath:AT1G01860 cmu:TC_0633 mta:Moth_0052 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02527GidB62-161 aaPF00398RrnaAD67-302 aaPF05175MTS79-166 aaPF13679Methyltransf_3279-144 aaPF02353CMAS80-149 aaPF01209Ubie_methyltran82-168 aaPF06325PrmA89-164 aaPF01135PCMT90-148 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G139010 | PF02527 | GidB | 62 | 161 | 0.025 | 14.7 |
| TkA03G139010 | PF00398 | RrnaAD | 67 | 302 | 3.5e-59 | 200.8 |
| TkA03G139010 | PF05175 | MTS | 79 | 166 | 9.7e-06 | 26.0 |
| TkA03G139010 | PF13679 | Methyltransf_32 | 79 | 144 | 0.086 | 13.5 |
| TkA03G139010 | PF02353 | CMAS | 80 | 149 | 0.041 | 13.9 |
| TkA03G139010 | PF01209 | Ubie_methyltran | 82 | 168 | 0.00079 | 19.6 |
| TkA03G139010 | PF06325 | PrmA | 89 | 164 | 4.8e-05 | 23.7 |
| TkA03G139010 | PF01135 | PCMT | 90 | 148 | 0.085 | 13.3 |
| TkA03G139010 | PF12847 | Methyltransf_18 | 91 | 152 | 0.22 | 12.2 |
| TkA03G139010 | PF13847 | Methyltransf_31 | 92 | 163 | 5.4e-05 | 23.7 |
| TkA03G139010 | PF13489 | Methyltransf_23 | 92 | 161 | 0.0012 | 19.3 |
| TkA03G139010 | PF05219 | DREV | 92 | 132 | 0.041 | 13.7 |
| TkA03G139010 | PF01596 | Methyltransf_3 | 92 | 152 | 0.092 | 12.8 |
| TkA03G139010 | PF02390 | Methyltransf_4 | 94 | 151 | 0.038 | 14.2 |
| TkA03G139010 | PF13649 | Methyltransf_25 | 95 | 163 | 1.9e-09 | 38.8 |
| TkA03G139010 | PF08241 | Methyltransf_11 | 96 | 163 | 1.9e-06 | 29.1 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.