TkA03G137480 | RubberDandelionOmics

Gene overview

TkA03G137480

Reference: TK1151 Chr: Chr03 Coordinates: 35224834-35229128 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2720 bp · TkA03G137480|TK1151|cDNA

GGTTGAGCACATGGTGGTCATCTGTTCACGGAGTCGCCGACATTCGTGTCAATCAAAAAATCATTAACAACGTTATGAACGAAGGAAAGTGATTCGGATTCGGAAACAATATAGTTTTCAAGTTCATCGAATCCCTCCGCAACCCCGCAACAGCTTACAGCTCTACTCATCTGAACTTGAAATACCACCAACAATCGCTGCTTAACTTCCAATCCCCTCGATTTATATAACTTCTGTAGCTCTAAATTACTTCACTACTG...

CDS

Download CDS FASTA

2412 bp · TkA03G137480|TK1151|CDS

ATGGGAAATCTCAAGGATTTTCATCAAGTTTTCTGCATTGGGACGGCCGATACCAAGCTTGAAGAACTGCTATTTCTCTCCGAGTCTGTCCGATCCAATCTCACGAACTTTTCCCCTACTTCTTCCTCCAAGGTAAAAGTTGTAGTTATAGATGTGTCAGTTGGATCAAAAGAGATTAACAGCTTCAAAGATTTTGAGTTCGTATCCCGAAAGGAACTTCTCTCTACCTACTCCGAATCTCTAAATCAACCAGAAACACA...

Protein

Download Protein FASTA

803 aa · TkA03G137480|TK1151|PROTEIN

MGNLKDFHQVFCIGTADTKLEELLFLSESVRSNLTNFSPTSSSKVKVVVIDVSVGSKEINSFKDFEFVSRKELLSTYSESLNQPETQIPESRSEALAIMNKALTLHLKNAHHRGSLAGVVGLGGSGGTSLMSSAFRSLPLGLPKIIVSTIASGQTEGYIGTSDLILFPSVVDICGINNVSRVILSNAGAAFSGMVSGKLLNLKDSYSGNDKFTLGLTMFGVTTPCVNAVKERLNKEGYETLVFHATGVGGRAMEDLVRGG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G137480`
TK1151 ID	TkA03G137480
OH-1004 ID	LXL04_007206
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G137480`
Location	Chr03:35224834-35229128 (+)
Description	Similar to tm-1: ToMV susceptible protein tm-1(GCR26)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007206` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0044830 host-mediated perturbation of viral RNA genome replication Biological Process GO:0051607 defense response to virus Biological Process GO:0003824 catalytic activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0042803 protein homodimerization activity Molecular Function
KEGG gene cross-reference	rhi:NGR_a02140 sen:SACE_5696 sly:100134884 ype:YPO3839 ypk:y0391 ypm:YP_3209 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.510

Rank 1 · TkA03G137480 · TK1151

Nucleus0.194

Rank 2 · TkA03G137480 · TK1151

Plastid0.150

Rank 3 · TkA03G137480 · TK1151

Peroxisome0.127

Rank 4 · TkA03G137480 · TK1151

Mitochondrion0.118

Rank 5 · TkA03G137480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06792UPF02619-197 aa

PF14500MMS19_N25-111 aa

PF00871Acetate_kinase41-106 aa

PF23189UPF0261_C211-419 aa

PF19718USP47_C395-440 aa

PF00871Acetate_kinase395-424 aa

PF14500MMS19_N398-476 aa

PF06792UPF0261402-460 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G137480	`PF06792`	UPF0261	9	197	2.9e-54	184.4
TkA03G137480	`PF14500`	MMS19_N	25	111	0.0029	18.0
TkA03G137480	`PF00871`	Acetate_kinase	41	106	0.18	11.2
TkA03G137480	`PF23189`	UPF0261_C	211	419	3.8e-81	272.2
TkA03G137480	`PF19718`	USP47_C	395	440	0.012	15.8
TkA03G137480	`PF00871`	Acetate_kinase	395	424	0.18	11.2
TkA03G137480	`PF14500`	MMS19_N	398	476	0.0029	18.0
TkA03G137480	`PF06792`	UPF0261	402	460	2.9e-54	184.4
TkA03G137480	`PF09370`	PEP_hydrolase	477	741	1.1e-132	441.9
TkA03G137480	`PF00871`	Acetate_kinase	587	657	0.18	11.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card