TkA03G132880 | RubberDandelionOmics

Gene overview

TkA03G132880

Reference: TK1151 Chr: Chr03 Coordinates: 34047739-34053009 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1556 bp · TkA03G132880|TK1151|cDNA

GGTTATTGCTCCACCGTCTTTGTGTTCTTGAGCACCAAACGAGCAGCGTGAGATCGATTGAAGTACCCCGGTTCTTAAGAATTTGATTTTTATCCTGTTCGGTATCGGGACAAAATTGAACCCCACTGGTATGTATGTACTCCTTTTTCACGGATTGTTGTTATTCTTGATTACTCCTGAAGATTCTGACCTCCTCTTTACAGCCACCTCCAACCGACACCATCTATAAGACAAGTGTTTTTTTTATGATATTGTTATTC...

CDS

Download CDS FASTA

570 bp · TkA03G132880|TK1151|CDS

ATGGATCCTAATAGTTACGTGAAGGTCAAATGCATTGCTACTGGCTCTCGAAGTCAAAGTGAAGTATTCAACGATTTGGTGGTCAAAAAGAAAGCTTCACACAAACACATGCCAACAAGAATCAAAAGACCAAAACTACTATATATCAAGGGCGCTTTAAGTGGGTCTGAAGGGTTTTCATCGTTTGACTCAATGAACCATGAAAAGAACAGACTTGATTCGGTTAATGGGATGATAGAGAAATGCAATCCAAATGTTAT...

Protein

Download Protein FASTA

189 aa · TkA03G132880|TK1151|PROTEIN

MDPNSYVKVKCIATGSRSQSEVFNDLVVKKKASHKHMPTRIKRPKLLYIKGALSGSEGFSSFDSMNHEKNRLDSVNGMIEKCNPNVILVEKTVSRDIQEYVLAKGMTLVLDMKMNRHLVSHNNGRVIGIGNVNIAFERDFPSLGAEEKQINGEIGRVPSPGLTTVIQSLPIGNTVVIGGDGWTPILCLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G132880`
TK1151 ID	TkA03G132880
OH-1004 ID	LXL04_031416
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 61.376 / OH-1004 6.013 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G132880

Location Chr03:34047739-34053009 (-)

Description Similar to FAB1D: Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1D

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g34260`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	No verified direct reference in this release
`At4g33240`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	Arabidopsis FAB1/PIKfyve proteins are essential for development of viable pollen.2009 · DOI: 10.1104/pp.109.146159 Loss-of-function and gain-of-function mutations in FAB1A/B impair endomembrane homeostasis, conferring pleiotropic developmental abnormalities in Arabidopsis.2011 · DOI: 10.1104/pp.110.167981 Arabidopsis FAB1A/B is possibly involved in the recycling of auxin transporters.2011 · DOI: 10.4161/psb.6.4.15023
`At3g14270`	The PI(3,5)P2 regulatory complex regulates both the synthesis and turnover of phosphatidylinositol 3,5-bisphosphate (PtdIns(3,5)P2).	Arabidopsis FAB1/PIKfyve proteins are essential for development of viable pollen.2009 · DOI: 10.1104/pp.109.146159 Loss-of-function and gain-of-function mutations in FAB1A/B impair endomembrane homeostasis, conferring pleiotropic developmental abnormalities in Arabidopsis.2011 · DOI: 10.1104/pp.110.167981

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031416 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007033 vacuole organization Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0010008 endosome membrane Cellular Component

GO:0000285 1-phosphatidylinositol-3-phosphate 5-kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G34260

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.406

Rank 1 · TkA03G132880 · TK1151

Cytoplasm0.397

Rank 2 · TkA03G132880 · TK1151

Cell membrane0.083

Rank 3 · TkA03G132880 · TK1151

Plastid0.069

Rank 4 · TkA03G132880 · TK1151

Mitochondrion0.061

Rank 5 · TkA03G132880 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00118Cpn60_TCP17-114 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G132880	`PF00118`	Cpn60_TCP1	7	114	2.5e-06	27.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XID0`	Arabidopsis thaliana	sp\|Q9XID0\|FAB1D_ARATH Putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1D	49.600%	Swiss-Prot	Medium
`Q0WUR5`	Arabidopsis thaliana	sp\|Q0WUR5\|FAB1A_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1A	46.200%	Swiss-Prot	Medium
`Q9LUM0`	Arabidopsis thaliana	sp\|Q9LUM0\|FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B	44.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card