TkA03G130660 | RubberDandelionOmics

Gene overview

TkA03G130660

Reference: TK1151 Chr: Chr03 Coordinates: 33511363-33514817 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2040 bp · TkA03G130660|TK1151|cDNA

ATGGAGTGAGCCTTTGAACACAACGAACGATGCGACGGTGACCGGCGAAGCCACAGAGACGGAATCCGGTGACGAAAAGCTAGAGGAGGTGAAGCCGCAGGCGGTTCCGGTGAGGCGGAGAGGGGTGGAGATCGATGATGAGGTCCACATAATGCATTATCCTTCGTCCTTCGACTCAGCAGTTTACTCTTCCTTTGAAGACACGGAAATACAAAATTGAGCAACAAATGGCAATGCAGATTAGACGGAACATGTGTTCA...

CDS

Download CDS FASTA

1401 bp · TkA03G130660|TK1151|CDS

ATGAGGGTCCTCCTCCTCTATAATTCACCATCCTCTTCATTCTCAATACCACCACCACCACCTACAACCACCACTCACCGCCCTCAAAAGCCCCTAAAACCATCTTTCATCCGTTCACTAACTGCAACTACCCTCTCTTTTAATCTCCTCTTTTTCTCACCACTCTCTCCTCTCCCTCCTCTTTCAATTGCTTCCGATTTCAGTCCTTCAAGTTCACAATTGGAGTGTCGTGAAGAAGATCAATTTATTGAAGAGGAAAA...

Protein

Download Protein FASTA

466 aa · TkA03G130660|TK1151|PROTEIN

MRVLLLYNSPSSSFSIPPPPPTTTTHRPQKPLKPSFIRSLTATTLSFNLLFFSPLSPLPPLSIASDFSPSSSQLECREEDQFIEEEKAPELVTNEELVKEAWEVVNDSYLDTGRNQWSPESWLQKKEDIIGTYLPSRSKAQDVIRKMLSTLHDPYTRFLSPSELSKMGRYDMSGIGVNLREIPDENGEVKLKVLGLILDGPAYVAGVRQGDELLSINGVDIKGKSSFEALTLLQGPTDTSVNITVKHGNCGPIKSVDLKR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G130660`
TK1151 ID	TkA03G130660
OH-1004 ID	LXL04_007177
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G130660

Location Chr03:33511363-33514817 (+)

Description Similar to CTPA1: Carboxyl-terminal-processing peptidase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46390`	Protease involved in the C-terminal processing of the chloroplastic D1 protein of photosystem II.	No verified direct reference in this release
`At4g17740`	Protease involved in the C-terminal processing of the chloroplastic D1 protein of photosystem II.	No verified direct reference in this release
`At3g57680`	Protease involved in the C-terminal processing of the chloroplastic D1 protein of photosystem II.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007177 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0007165 signal transduction Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0009543 chloroplast thylakoid lumen Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0031977 thylakoid lumen Cellular Component

GO:0004175 endopeptidase activity Molecular Function

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

KEGG gene cross-reference

ag:AAC49799

ath:AT4G17740

ath:AT5G46390

syn:slr0008

syp:SYNPCC7002_A0843

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.979

Rank 1 · TkA03G130660 · TK1151

Mitochondrion0.027

Rank 2 · TkA03G130660 · TK1151

Cytoplasm0.019

Rank 3 · TkA03G130660 · TK1151

Peroxisome0.016

Rank 4 · TkA03G130660 · TK1151

Cell membrane0.014

Rank 5 · TkA03G130660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00595PDZ172-245 aa

PF13180PDZ_2175-249 aa

PF17820PDZ_6199-246 aa

PF14685PDZ_Tricorn205-252 aa

PF03572Peptidase_S41282-443 aa

PF14685PDZ_Tricorn336-388 aa

PF14685PDZ_Tricorn416-440 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G130660	`PF00595`	PDZ	172	245	2.9e-06	28.3
TkA03G130660	`PF13180`	PDZ_2	175	249	3.4e-06	27.9
TkA03G130660	`PF17820`	PDZ_6	199	246	3.3e-09	37.0
TkA03G130660	`PF14685`	PDZ_Tricorn	205	252	0.011	16.6
TkA03G130660	`PF03572`	Peptidase_S41	282	443	3.1e-49	167.4
TkA03G130660	`PF14685`	PDZ_Tricorn	336	388	0.011	16.6
TkA03G130660	`PF14685`	PDZ_Tricorn	416	440	0.011	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KHG6`	Arabidopsis thaliana	sp\|F4KHG6\|CTPA1_ARATH Carboxyl-terminal-processing peptidase 1, chloroplastic	59.700%	Swiss-Prot	High
`O23614`	Arabidopsis thaliana	sp\|O23614\|CTPA2_ARATH Carboxyl-terminal-processing peptidase 2, chloroplastic	36.000%	Swiss-Prot	Medium
`F4J3G5`	Arabidopsis thaliana	sp\|F4J3G5\|CTPA3_ARATH Carboxyl-terminal-processing peptidase 3, chloroplastic	36.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card