TkA03G128790 | RubberDandelionOmics

Gene overview

TkA03G128790

Reference: TK1151 Chr: Chr03 Coordinates: 33047165-33051515 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1496 bp · TkA03G128790|TK1151|cDNA

AAATAGTGTGATCGTTTTGGGACTTACTCTGTTCGTTTATGCATTTCTTCTTCCTTTCTTCTCATCAATCGATCTATGAGAATCAGCTGGAGAAGTTTTGCAAGTTTATGGATCCACTAATTGATTCATCACCTCCTGAAGTTCACCAAGGCGTTTCATCTTTTAACTCCCGATTGAAACATAGGCTGCATAAATCAGAATTTTGGGCCCATTGCCTGCATCAGTCTGTTTCCATGGGTCAACAAGGGCTGGTGGATTTC...

CDS

Download CDS FASTA

1680 bp · TkA03G128790|TK1151|CDS

ATGTGGAGAAGAGGCTTTTGCAGCAGCACTGCGGCCTTAAACAACAAGAAATGGGACGCTCTTGTCATCGGCGGTGGTCACAACGGCCTTACTGCCGCTGCTTACCTAGCTCAGTCAGGACTCTCTGTCGCCGTCCTTGAGCGCCGCCACCTTATTGGTGGTGCCGCCATCACCGAAGAACTCATCCCTGGTTTCAAGTTCTCCCGCTGCAGCTACCTCCAGAGCCTCCTTCGCCCTTCTATCATTAGAGATCTGGAGTT...

Protein

Download Protein FASTA

559 aa · TkA03G128790|TK1151|PROTEIN

MWRRGFCSSTAALNNKKWDALVIGGGHNGLTAAAYLAQSGLSVAVLERRHLIGGAAITEELIPGFKFSRCSYLQSLLRPSIIRDLELHRHGLNLLKRSPSSFTPCLDGRYLLLGPDAELNHSEISKFSKRDADAYPSYENQLEKFCKFMDPLIDSSPPEVHQGVSSFNSRLKHRLHKSEFWAHCLHQSVSMGQQGLVDFMDLLLSPASNVLNRWFESEVLKATLATDAVIGTTANTQSPGSGYVLLHHVMGETDGDRGIW...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G128790`
TK1151 ID	TkA03G128790
OH-1004 ID	LXL04_007158
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G128790`
Location	Chr03:33047165-33051515 (-)
Description	Similar to PYROXD2: Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007158` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007005 mitochondrion organization Biological Process GO:0005739 mitochondrion Cellular Component GO:0005759 mitochondrial matrix Cellular Component GO:0016491 oxidoreductase activity Molecular Function
KEGG gene cross-reference	bta:519120 hsa:84795 mmu:74580 rno:309381 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.910

Rank 1 · TkA03G128790 · TK1151

Cytoplasm0.085

Rank 2 · TkA03G128790 · TK1151

Nucleus0.050

Rank 3 · TkA03G128790 · TK1151

Plastid0.031

Rank 4 · TkA03G128790 · TK1151

Cell membrane0.025

Rank 5 · TkA03G128790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01946Thi416-56 aa

PF01266DAO19-55 aa

PF12831FAD_oxidored19-56 aa

PF00890FAD_binding_219-55 aa

PF07992Pyr_redox_219-59 aa

PF01494FAD_binding_319-49 aa

PF03486HI0933_like19-53 aa

PF00070Pyr_redox20-53 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G128790	`PF01946`	Thi4	16	56	1.8e-06	28.1
TkA03G128790	`PF01266`	DAO	19	55	1.4e-10	42.0
TkA03G128790	`PF12831`	FAD_oxidored	19	56	2e-06	28.1
TkA03G128790	`PF00890`	FAD_binding_2	19	55	5.5e-06	26.5
TkA03G128790	`PF07992`	Pyr_redox_2	19	59	5.6e-06	26.7
TkA03G128790	`PF01494`	FAD_binding_3	19	49	0.001	19.1
TkA03G128790	`PF03486`	HI0933_like	19	53	0.0021	18.3
TkA03G128790	`PF00070`	Pyr_redox	20	53	1.3e-05	26.4
TkA03G128790	`PF01134`	GIDA	20	46	0.0022	17.8
TkA03G128790	`PF21799`	MurD-like_N	20	50	0.2	12.6
TkA03G128790	`PF04820`	Trp_halogenase	21	65	0.019	14.5
TkA03G128790	`PF13738`	Pyr_redox_3	21	50	0.19	11.6
TkA03G128790	`PF13450`	NAD_binding_8	22	69	1.1e-10	42.4
TkA03G128790	`PF01593`	Amino_oxidase	29	60	2.3e-13	51.0
TkA03G128790	`PF01266`	DAO	101	130	1.4e-10	42.0
TkA03G128790	`PF08050`	Tet_res_leader	181	191	6.8	7.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card