TkA03G118950 | RubberDandelionOmics

Gene overview

TkA03G118950

Reference: TK1151 Chr: Chr03 Coordinates: 30373954-30377360 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2042 bp · TkA03G118950|TK1151|cDNA

GGACTGTTTCTGTAGTTTACCGGAAATAATAAAACAGAGAGTGCCAAGCAGTAGACACCACGCACACTCTGTAGCGAGTAACAAAAAACCCCGAAGCTGGCCTACAGTCCGAAGCGAGCCATGGCGGAGCTCCGCCACTCTAGCTCGATCGGCGGCAGAGCAACACCGTCTCCTAGGAAACGCGACGATGTCACATCGCCACTTTCCGCAGACAATCAACCCCTCCATGACGACGACGACGGTGGTCGCGATCGTTACCC...

CDS

Download CDS FASTA

1659 bp · TkA03G118950|TK1151|CDS

ATGGCGGAGCTCCGCCACTCTAGCTCGATCGGCGGCAGAGCAACACCGTCTCCTAGGAAACGCGACGATGTCACATCGCCACTTTCCGCAGACAATCAACCCCTCCATGACGACGACGACGGTGGTCGCGATCGTTACCCTCGAGATCGGTTCCGTTCACTATTCTCCAATCATTTTCAGTTATTAGATGAAAGCGCTAGGTTTTATTCGAACAACTTCAAGATCCTGCTTCTACTCATCAGCATCCTCGTTTTCGCCGG...

Protein

Download Protein FASTA

552 aa · TkA03G118950|TK1151|PROTEIN

MAELRHSSSIGGRATPSPRKRDDVTSPLSADNQPLHDDDDGGRDRYPRDRFRSLFSNHFQLLDESARFYSNNFKILLLLISILVFAGMFSVYSVISRLNAPYLCKKDGITLHCPRVKEPPSLWENPLSTTTSWKPCAERRIGAISGLPEANETNGYIFIHAEGGLNQQRIAICNAVAVAKIMNATLILPVLKQDQIWKDQTKFEDIFDVDHFIDYLKDDVQIVRDIPSWFTDKSELFTSIRRTVKNIPKYAPAQFYIDNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G118950`
TK1151 ID	TkA03G118950
OH-1004 ID	LXL04_025804
Relationship / confidence	Rbh High Identity Coverage Local Synteny Minor Chr Pair / Probable
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.819 / OH-1004 99.819 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G118950

Location Chr03:30373954-30377360 (-)

Description Similar to PAGR: Protein PECTIC ARABINOGALACTAN SYNTHESIS-RELATED

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26370`	Glycosyltransferase involved in the biosynthesis of pectic type-II arabinogalactans.	A DUF-246 family glycosyltransferase-like gene affects male fertility and the biosynthesis of pectic arabinogalactans.2016 · DOI: 10.1186/s12870-016-0780-x
`At4g24530`	O-fucosyltransferase 31.	No verified direct reference in this release
`At2g01480`	Glycosyltransferase that plays a role in cell adhesion.	No verified direct reference in this release
`At5g65470`	O-fucosyltransferase 39.	No verified direct reference in this release
`At1g29200`	O-fucosyltransferase 8.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025804 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006004 fucose metabolic process Biological Process

GO:0007155 cell adhesion Biological Process

GO:0052325 cell wall pectin biosynthetic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0000137 Golgi cis cisterna Cellular Component

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005797 Golgi medial cisterna Cellular Component

GO:0005802 trans-Golgi network Cellular Component

KEGG gene cross-reference

ath:AT1G14970

ath:AT2G01480

ath:AT3G26370

ath:AT4G24530

ath:AT5G65470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Golgi apparatus0.816

Rank 1 · TkA03G118950 · TK1151

Endoplasmic reticulum0.079

Rank 2 · TkA03G118950 · TK1151

Cell membrane0.065

Rank 3 · TkA03G118950 · TK1151

Cytoplasm0.055

Rank 4 · TkA03G118950 · TK1151

Extracellular0.040

Rank 5 · TkA03G118950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10250O-FucT156-488 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G118950	`PF10250`	O-FucT	156	488	9.6e-98	328.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LIN9`	Arabidopsis thaliana	sp\|Q9LIN9\|PAGR_ARATH Protein PECTIC ARABINOGALACTAN SYNTHESIS-RELATED	81.700%	Swiss-Prot	High
`Q7Y030`	Arabidopsis thaliana	sp\|Q7Y030\|OFT31_ARATH O-fucosyltransferase 31	38.500%	Swiss-Prot	Medium
`Q9ZVF7`	Arabidopsis thaliana	sp\|Q9ZVF7\|ESMD1_ARATH Protein ESMERALDA 1	41.800%	Swiss-Prot	Medium
`Q0WUZ5`	Arabidopsis thaliana	sp\|Q0WUZ5\|OFT39_ARATH O-fucosyltransferase 39	38.300%	Swiss-Prot	Medium
`F4HZX7`	Arabidopsis thaliana	sp\|F4HZX7\|OFUT8_ARATH O-fucosyltransferase 8	38.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card